Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|051280
Gene name
Locationscaffold_2:3186749..3190952
Strand-
Gene length (bp)4203
Transcript length (bp)4116
Coding sequence length (bp)4116
Protein length (aa) 1372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.4E-66 883 1128
PF00665 rve Integrase core domain 1.7E-14 512 606
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.8E-08 98 167
PF13976 gag_pre-integrs GAG-pre-integrase domain 9.4E-08 427 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 232 1360 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 239 1368 3.0E-133
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 962 1275 7.0E-44
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1046 1278 5.0E-28
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 352 738 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 232 1360 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 239 1368 3.0E-133
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 962 1275 7.0E-44
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1046 1278 5.0E-28
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 352 738 1.0E-26
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 352 738 1.0E-26
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 352 738 1.0E-26
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 352 738 1.0E-26
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 352 738 1.0E-26
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 352 738 1.0E-26
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 352 738 1.0E-26
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 352 721 2.0E-26
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 352 721 2.0E-26
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 352 721 2.0E-26
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 352 721 3.0E-26
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 352 721 3.0E-26
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 895 1355 7.0E-25
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 895 1355 2.0E-23
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 895 1355 2.0E-23
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 895 1355 5.0E-23
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 895 1355 5.0E-23
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 851 1355 6.0E-23
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 895 1355 6.0E-23
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 895 1355 8.0E-23
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 867 1355 1.0E-22
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 867 1355 1.0E-22
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 867 1355 1.0E-22
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 867 1355 1.0E-22
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 867 1355 1.0E-22
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 867 1355 1.0E-22
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 895 1355 1.0E-22
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 895 1355 1.0E-22
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 895 1355 1.0E-22
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 895 1355 1.0E-22
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 895 1355 1.0E-22
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 851 1355 2.0E-22
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 867 1355 2.0E-22
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 867 1355 2.0E-22
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 895 1355 2.0E-22
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 895 1355 2.0E-22
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 895 1355 2.0E-22
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 895 1355 1.0E-21
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 867 1277 3.0E-21
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 895 1355 3.0E-21
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 867 1277 3.0E-21
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 867 1355 4.0E-21
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 895 1355 5.0E-21
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 895 1355 6.0E-21
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 895 1355 6.0E-21
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 895 1355 1.0E-20
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 895 1355 1.0E-20
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 895 1355 1.0E-20
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 895 1355 1.0E-20
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 895 1355 2.0E-20
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 895 1355 2.0E-20
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 895 1355 2.0E-20
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 895 1355 2.0E-20
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 895 1355 2.0E-20
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 895 1355 2.0E-20
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 895 1355 3.0E-20
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 895 1355 3.0E-20
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 377 721 2.0E-19
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 352 645 4.0E-19
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 377 645 5.0E-19
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 377 721 5.0E-19
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 377 721 5.0E-19
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 377 645 5.0E-19
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 377 645 6.0E-19
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 377 645 6.0E-19
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 377 721 6.0E-19
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 377 645 7.0E-19
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 377 645 7.0E-19
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 377 721 7.0E-19
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 377 645 8.0E-19
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 377 721 8.0E-19
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 377 645 8.0E-19
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 377 645 8.0E-19
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 377 645 8.0E-19
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 377 645 9.0E-19
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 377 645 1.0E-18
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 377 645 1.0E-18
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 377 645 1.0E-18
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 377 645 2.0E-18
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 377 721 2.0E-18
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 377 645 2.0E-18
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 377 645 2.0E-18
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 377 721 2.0E-18
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 377 721 2.0E-18
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 377 645 2.0E-18
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 377 645 2.0E-18
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 377 645 2.0E-18
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 377 721 2.0E-18
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 377 645 4.0E-18
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 865 961 5.0E-18
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 406 732 2.0E-16
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 406 732 2.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 406 732 3.0E-16
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 487 645 3.0E-15
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 895 1209 1.0E-14
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 867 1130 1.0E-13
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 448 682 3.0E-09
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 448 682 4.0E-09
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 448 682 7.0E-09
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 448 682 1.0E-07
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 448 682 1.0E-07
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 448 682 3.0E-07
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 621 708 2.0E-06
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 448 679 2.0E-06
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 448 679 3.0E-06
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1162 1271 3.0E-06
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 448 679 4.0E-06
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 481 680 6.0E-06
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 481 680 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|051280
MSSTAVINDVLPPTVPALDVSGTNWAIFELRFRMIVQGKGLWGHFDGSTPRPTPPRAITPASHPSTPVLATSPST
AAAAVQVPIPSTPTPTVADIDAWDRNENIALSLLAQRIPDSTLVVVSAQTTVKLMWDKIVRDYTYKSAFSQANLR
QDFMSSRCPSGGDCNNSIPTSLVVDICFQINSQQLVSILLFTTLLILICSSYDCDEWDRTRRFAKKGQKSEGNDA
LAVEEEGKGKKKGKGKGKAKDGERKKGPCWFCQGEHLKKDCAEWKKKQEEGSSKKDQSKSSANVAEEDDDESFAV
DIDKGGKVSETIARVEVFDSGSSRHISPYRDMFTSLQMIQPCALRTANQQCLNAIGKGEIKLDLPNGDSRSQLHL
KEALYAPEAGYTLISIGRLDTDGFSTTFRDNKCIIRDSNGARVAEIPRNEKGLYKLVKSSCDEVNVAVETLTVDA
LHRRLGHISSVAARKLVTSGLVSGLKLSGDESNSITCDSCSYAKATRLPIAKVCEGERALKVGEEVHTDVWGPSR
VATKKGRRYYVTFTDDYSRWTHIEFLSNKSDVFEAYKQFEAWCETQFNSRIKVLHSDRGGEYTSEEFQKYLKSRG
TQTKLTVHDTPQHNGVAERRNRTIVERVRALLHASCLPKSLWAEAAAHIVWLMNRTSTKAVQGMTPFEALYGRKP
RLGNVQEWGDEVWVHQAGGDKLGARAKKGKWLGYDTESNGSRILFPDTGTIKIERNFRFIKDQTNLQLEGEYIPT
PEVPASSTPAISSPELHESTTTPVSPSVGSTPTQRESSPAPIQQPDSPDQVPVVRRSQRTRQPSQKAREILEGKG
ITVVEELDWEEVHVLVTEMEIMEALEPRTWKEATQRTDWPLWKKAMEEELATLQAAGTWELVDCPLGINIVGSKW
VFKAKKDAAGNIVRYKARLVAQGYSQIPGVDYFDTFAPVARLSSIRTVLAIATARNLEIHQIDVKGAYLNGILND
DETVYMRQPPGFHDTTHPRYVCHLKKTLYGLKQSGRRWYQRLCEILIDNLGYSRCDVDHGVFFRVIQDDLIIILV
HVDDCTLVATKLELIRELKERMNEFVEVTDLGEIHWLLGIEIRRNREEGKLYMSQRSYIDSCLRRYGFEDAKPVS
IPMDPSIHLSTNQSPNSTTEIARMARIPYQEAVGSLMYAAIATRPDIAFAIQVLSKFSKNPGEKHWEAVKRVFRY
LKGTRELWLTFGGQDDTLKGFADADGNMAEDRHATSGFAFIINGGAVSWSAKRQEIVTLSTTESEYVAATHAAKE
TLWLRSLISQVFNITLPTTRLFSDNQSAIALTKDHQFHSRTKHIDIRYHFIRWIVEEGKIRLVYCPTEDMVADTL
TKALPSPKIKHFACELGLTTV*
Coding >AgabiH97|051280
ATGTCAAGTACAGCAGTTATAAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCGATATTCGAGTTGCGTTTCCGGATGATTGTCCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGATATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTCTAGCTCAGCGAATTCCTGACTCCACACTTGTAGTGGTTTCTGCCCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCACGTTGCCCAAGTGGAGGTGACTGCAATAATTCAATCCCTACCTCGTTGGTTGTCGAC
ATATGCTTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCTGATATGCTCA
TCGTATGATTGCGACGAATGGGACCGTACCCGACGTTTCGCCAAGAAAGGTCAAAAATCTGAAGGGAATGATGCC
TTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAAGGGAAAGGGAAAGGGAAAGCTAAAGATGGCGAGAGGAAG
AAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAGAAACAAGAGGAA
GGGTCTAGTAAGAAAGACCAATCTAAATCAAGTGCAAATGTAGCTGAAGAAGATGATGACGAGTCTTTTGCAGTA
GACATAGATAAAGGGGGAAAGGTTTCCGAGACCATAGCCCGAGTCGAAGTTTTCGATTCCGGATCCTCTCGACAC
ATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGCGAACTGCAAATCAGCAA
TGCCTAAACGCAATCGGGAAAGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCCCAACTACATCTT
AAAGAAGCACTGTATGCACCTGAAGCTGGTTATACTCTCATTTCTATTGGTCGTCTGGACACCGACGGTTTTTCC
ACGACGTTCAGGGATAATAAATGCATAATTCGAGACTCAAATGGTGCTCGTGTCGCCGAAATTCCTAGAAATGAG
AAGGGGCTGTATAAATTGGTCAAATCCAGCTGCGATGAAGTAAACGTAGCAGTTGAAACCCTTACCGTTGATGCA
CTACATCGTCGTCTTGGTCATATATCATCTGTGGCCGCTCGAAAACTTGTAACGAGTGGACTAGTATCTGGACTA
AAGTTGAGCGGAGATGAATCTAACTCAATTACCTGTGATTCATGTTCATATGCCAAAGCTACACGCTTGCCGATA
GCGAAAGTTTGTGAAGGTGAAAGAGCGTTGAAAGTTGGCGAGGAAGTTCATACGGATGTATGGGGACCATCCAGA
GTTGCGACAAAGAAAGGACGACGTTACTACGTTACGTTCACGGACGACTACTCGAGGTGGACTCACATTGAGTTC
TTATCCAACAAATCGGATGTTTTTGAAGCATACAAGCAGTTTGAAGCCTGGTGCGAGACTCAGTTCAATTCTCGT
ATCAAAGTTCTCCATTCAGATCGAGGAGGGGAATATACGTCTGAAGAATTTCAGAAGTATCTCAAATCGCGAGGA
ACTCAAACGAAACTTACAGTTCATGATACGCCTCAACATAACGGAGTAGCAGAACGTCGTAATCGAACCATCGTT
GAACGTGTTCGAGCATTGTTACATGCTAGTTGTCTTCCAAAGAGCCTATGGGCTGAAGCTGCCGCCCACATAGTA
TGGTTGATGAATAGAACCAGTACTAAAGCTGTTCAAGGTATGACACCTTTCGAAGCTTTGTATGGCCGTAAACCT
CGACTCGGAAACGTTCAGGAGTGGGGTGATGAAGTTTGGGTTCACCAAGCTGGAGGGGACAAGTTGGGAGCACGA
GCAAAAAAGGGGAAATGGTTGGGATATGATACCGAGAGTAACGGCTCACGAATTTTGTTCCCTGATACTGGGACA
ATCAAAATTGAGCGTAACTTTCGCTTTATCAAAGATCAGACTAACCTACAGCTCGAGGGGGAGTATATCCCGACT
CCTGAAGTACCCGCGTCGTCCACACCGGCTATTTCATCACCAGAATTGCATGAATCTACCACCACTCCAGTTTCA
CCAAGCGTTGGTAGTACCCCCACTCAACGCGAGTCGTCACCGGCACCAATTCAACAACCTGATTCACCGGATCAA
GTACCAGTTGTTAGACGGTCACAAAGAACACGGCAGCCGAGCCAGAAAGCTCGCGAAATTCTTGAAGGAAAAGGC
ATCACCGTTGTAGAAGAATTGGACTGGGAGGAAGTTCATGTATTAGTAACAGAGATGGAAATAATGGAGGCTTTA
GAACCTCGTACCTGGAAAGAGGCCACACAGAGGACTGACTGGCCGTTGTGGAAGAAAGCGATGGAGGAAGAATTA
GCCACGTTGCAGGCTGCTGGCACCTGGGAACTAGTTGATTGTCCGCTTGGCATCAACATCGTGGGATCAAAGTGG
GTCTTCAAAGCGAAGAAGGATGCGGCAGGTAACATTGTCCGCTATAAAGCTCGTTTAGTGGCCCAAGGTTATTCA
CAGATCCCAGGAGTCGACTATTTCGACACTTTTGCGCCAGTAGCGCGACTTTCGTCAATCCGAACCGTACTCGCT
ATTGCTACTGCCCGGAATCTTGAAATCCATCAAATTGATGTCAAAGGGGCGTATCTTAATGGTATATTAAATGAT
GACGAAACTGTTTACATGCGTCAACCTCCCGGTTTCCACGACACCACTCATCCCCGTTATGTCTGTCATCTCAAA
AAGACACTTTATGGTCTTAAACAGTCCGGAAGACGTTGGTATCAACGCCTTTGTGAAATTCTTATCGACAATCTA
GGCTATTCTCGCTGTGATGTCGATCACGGTGTTTTCTTCCGTGTCATTCAAGATGATTTGATCATAATCCTTGTT
CATGTGGACGACTGTACTCTCGTGGCAACAAAACTCGAGCTTATTAGAGAGTTGAAAGAGAGGATGAATGAGTTT
GTAGAGGTGACTGATCTCGGAGAGATTCACTGGCTTCTAGGGATTGAAATTCGACGAAATCGAGAGGAAGGTAAA
TTGTATATGTCTCAAAGGTCGTATATTGATTCGTGTCTTCGGCGATACGGTTTCGAGGATGCTAAACCAGTCAGT
ATCCCTATGGATCCATCCATTCATCTTTCTACCAACCAATCACCGAATTCTACTACGGAAATTGCTCGCATGGCA
CGTATTCCCTACCAAGAGGCTGTAGGTTCGCTTATGTATGCAGCAATTGCCACTCGACCTGATATTGCCTTCGCA
ATACAAGTCCTTTCGAAATTCTCGAAGAATCCTGGAGAGAAGCATTGGGAGGCTGTAAAGAGAGTTTTCCGGTAT
CTAAAAGGTACGAGAGAGTTGTGGTTGACTTTTGGAGGTCAAGACGATACTCTAAAGGGTTTTGCTGATGCAGAT
GGGAATATGGCAGAGGATAGGCATGCGACTTCGGGTTTCGCCTTTATCATAAACGGAGGTGCTGTTTCATGGAGT
GCGAAACGACAAGAAATCGTCACCTTGTCGACTACTGAATCCGAATACGTGGCCGCTACACATGCCGCCAAAGAA
ACTCTATGGCTCCGTTCTCTCATTTCCCAAGTATTCAATATCACTCTCCCCACTACTCGTCTATTCTCGGACAAT
CAATCGGCTATCGCGCTGACAAAAGATCATCAATTTCATAGTCGAACAAAACATATTGACATACGTTATCATTTC
ATACGATGGATAGTCGAAGAAGGGAAAATCCGGCTTGTCTATTGTCCAACAGAGGATATGGTTGCAGACACATTG
ACGAAAGCTCTACCATCTCCAAAGATTAAGCATTTCGCATGTGAGCTAGGGCTCACCACGGTTTGA
Transcript >AgabiH97|051280
ATGTCAAGTACAGCAGTTATAAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCGATATTCGAGTTGCGTTTCCGGATGATTGTCCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGATATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTCTAGCTCAGCGAATTCCTGACTCCACACTTGTAGTGGTTTCTGCCCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCACGTTGCCCAAGTGGAGGTGACTGCAATAATTCAATCCCTACCTCGTTGGTTGTCGAC
ATATGCTTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCTGATATGCTCA
TCGTATGATTGCGACGAATGGGACCGTACCCGACGTTTCGCCAAGAAAGGTCAAAAATCTGAAGGGAATGATGCC
TTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAAGGGAAAGGGAAAGGGAAAGCTAAAGATGGCGAGAGGAAG
AAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAGAAACAAGAGGAA
GGGTCTAGTAAGAAAGACCAATCTAAATCAAGTGCAAATGTAGCTGAAGAAGATGATGACGAGTCTTTTGCAGTA
GACATAGATAAAGGGGGAAAGGTTTCCGAGACCATAGCCCGAGTCGAAGTTTTCGATTCCGGATCCTCTCGACAC
ATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGCGAACTGCAAATCAGCAA
TGCCTAAACGCAATCGGGAAAGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCCCAACTACATCTT
AAAGAAGCACTGTATGCACCTGAAGCTGGTTATACTCTCATTTCTATTGGTCGTCTGGACACCGACGGTTTTTCC
ACGACGTTCAGGGATAATAAATGCATAATTCGAGACTCAAATGGTGCTCGTGTCGCCGAAATTCCTAGAAATGAG
AAGGGGCTGTATAAATTGGTCAAATCCAGCTGCGATGAAGTAAACGTAGCAGTTGAAACCCTTACCGTTGATGCA
CTACATCGTCGTCTTGGTCATATATCATCTGTGGCCGCTCGAAAACTTGTAACGAGTGGACTAGTATCTGGACTA
AAGTTGAGCGGAGATGAATCTAACTCAATTACCTGTGATTCATGTTCATATGCCAAAGCTACACGCTTGCCGATA
GCGAAAGTTTGTGAAGGTGAAAGAGCGTTGAAAGTTGGCGAGGAAGTTCATACGGATGTATGGGGACCATCCAGA
GTTGCGACAAAGAAAGGACGACGTTACTACGTTACGTTCACGGACGACTACTCGAGGTGGACTCACATTGAGTTC
TTATCCAACAAATCGGATGTTTTTGAAGCATACAAGCAGTTTGAAGCCTGGTGCGAGACTCAGTTCAATTCTCGT
ATCAAAGTTCTCCATTCAGATCGAGGAGGGGAATATACGTCTGAAGAATTTCAGAAGTATCTCAAATCGCGAGGA
ACTCAAACGAAACTTACAGTTCATGATACGCCTCAACATAACGGAGTAGCAGAACGTCGTAATCGAACCATCGTT
GAACGTGTTCGAGCATTGTTACATGCTAGTTGTCTTCCAAAGAGCCTATGGGCTGAAGCTGCCGCCCACATAGTA
TGGTTGATGAATAGAACCAGTACTAAAGCTGTTCAAGGTATGACACCTTTCGAAGCTTTGTATGGCCGTAAACCT
CGACTCGGAAACGTTCAGGAGTGGGGTGATGAAGTTTGGGTTCACCAAGCTGGAGGGGACAAGTTGGGAGCACGA
GCAAAAAAGGGGAAATGGTTGGGATATGATACCGAGAGTAACGGCTCACGAATTTTGTTCCCTGATACTGGGACA
ATCAAAATTGAGCGTAACTTTCGCTTTATCAAAGATCAGACTAACCTACAGCTCGAGGGGGAGTATATCCCGACT
CCTGAAGTACCCGCGTCGTCCACACCGGCTATTTCATCACCAGAATTGCATGAATCTACCACCACTCCAGTTTCA
CCAAGCGTTGGTAGTACCCCCACTCAACGCGAGTCGTCACCGGCACCAATTCAACAACCTGATTCACCGGATCAA
GTACCAGTTGTTAGACGGTCACAAAGAACACGGCAGCCGAGCCAGAAAGCTCGCGAAATTCTTGAAGGAAAAGGC
ATCACCGTTGTAGAAGAATTGGACTGGGAGGAAGTTCATGTATTAGTAACAGAGATGGAAATAATGGAGGCTTTA
GAACCTCGTACCTGGAAAGAGGCCACACAGAGGACTGACTGGCCGTTGTGGAAGAAAGCGATGGAGGAAGAATTA
GCCACGTTGCAGGCTGCTGGCACCTGGGAACTAGTTGATTGTCCGCTTGGCATCAACATCGTGGGATCAAAGTGG
GTCTTCAAAGCGAAGAAGGATGCGGCAGGTAACATTGTCCGCTATAAAGCTCGTTTAGTGGCCCAAGGTTATTCA
CAGATCCCAGGAGTCGACTATTTCGACACTTTTGCGCCAGTAGCGCGACTTTCGTCAATCCGAACCGTACTCGCT
ATTGCTACTGCCCGGAATCTTGAAATCCATCAAATTGATGTCAAAGGGGCGTATCTTAATGGTATATTAAATGAT
GACGAAACTGTTTACATGCGTCAACCTCCCGGTTTCCACGACACCACTCATCCCCGTTATGTCTGTCATCTCAAA
AAGACACTTTATGGTCTTAAACAGTCCGGAAGACGTTGGTATCAACGCCTTTGTGAAATTCTTATCGACAATCTA
GGCTATTCTCGCTGTGATGTCGATCACGGTGTTTTCTTCCGTGTCATTCAAGATGATTTGATCATAATCCTTGTT
CATGTGGACGACTGTACTCTCGTGGCAACAAAACTCGAGCTTATTAGAGAGTTGAAAGAGAGGATGAATGAGTTT
GTAGAGGTGACTGATCTCGGAGAGATTCACTGGCTTCTAGGGATTGAAATTCGACGAAATCGAGAGGAAGGTAAA
TTGTATATGTCTCAAAGGTCGTATATTGATTCGTGTCTTCGGCGATACGGTTTCGAGGATGCTAAACCAGTCAGT
ATCCCTATGGATCCATCCATTCATCTTTCTACCAACCAATCACCGAATTCTACTACGGAAATTGCTCGCATGGCA
CGTATTCCCTACCAAGAGGCTGTAGGTTCGCTTATGTATGCAGCAATTGCCACTCGACCTGATATTGCCTTCGCA
ATACAAGTCCTTTCGAAATTCTCGAAGAATCCTGGAGAGAAGCATTGGGAGGCTGTAAAGAGAGTTTTCCGGTAT
CTAAAAGGTACGAGAGAGTTGTGGTTGACTTTTGGAGGTCAAGACGATACTCTAAAGGGTTTTGCTGATGCAGAT
GGGAATATGGCAGAGGATAGGCATGCGACTTCGGGTTTCGCCTTTATCATAAACGGAGGTGCTGTTTCATGGAGT
GCGAAACGACAAGAAATCGTCACCTTGTCGACTACTGAATCCGAATACGTGGCCGCTACACATGCCGCCAAAGAA
ACTCTATGGCTCCGTTCTCTCATTTCCCAAGTATTCAATATCACTCTCCCCACTACTCGTCTATTCTCGGACAAT
CAATCGGCTATCGCGCTGACAAAAGATCATCAATTTCATAGTCGAACAAAACATATTGACATACGTTATCATTTC
ATACGATGGATAGTCGAAGAAGGGAAAATCCGGCTTGTCTATTGTCCAACAGAGGATATGGTTGCAGACACATTG
ACGAAAGCTCTACCATCTCCAAAGATTAAGCATTTCGCATGTGAGCTAGGGCTCACCACGGTTTGA
Gene >AgabiH97|051280
ATGTCAAGTACAGCAGTTATAAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCGATATTCGAGTTGCGTTTCCGGATGATTGTCCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGATATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTCTAGCTCAGCGAATTCCTGACTCCACACTTGTAGTGGTTTCTGCCCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCACGTTGCCCAAGTGGAGGTGACGTACGCTTGTTCTTAAACGAGTTACGGAGCTAAAAA
GGCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCG
TTGGTTGTCGACATATGCTTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATC
CTGATATGCTCATCGTATGATTGCGACGAATGGGACCGTACCCGACGTTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCCTTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAAGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAGTAAGAAAGACCAATCTAAATCAAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGGTTTCCGAGACCATAGCCCGAGTCGAAGTTTTCGATTCCGGA
TCCTCTCGACACATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGCGAACT
GCAAATCAGCAATGCCTAAACGCAATCGGGAAAGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCC
CAACTACATCTTAAAGAAGCACTGTATGCACCTGAAGCTGGTTATACTCTCATTTCTATTGGTCGTCTGGACACC
GACGGTTTTTCCACGACGTTCAGGGATAATAAATGCATAATTCGAGACTCAAATGGTGCTCGTGTCGCCGAAATT
CCTAGAAATGAGAAGGGGCTGTATAAATTGGTCAAATCCAGCTGCGATGAAGTAAACGTAGCAGTTGAAACCCTT
ACCGTTGATGCACTACATCGTCGTCTTGGTCATATATCATCTGTGGCCGCTCGAAAACTTGTAACGAGTGGACTA
GTATCTGGACTAAAGTTGAGCGGAGATGAATCTAACTCAATTACCTGTGATTCATGTTCATATGCCAAAGCTACA
CGCTTGCCGATAGCGAAAGTTTGTGAAGGTGAAAGAGCGTTGAAAGTTGGCGAGGAAGTTCATACGGATGTATGG
GGACCATCCAGAGTTGCGACAAAGAAAGGACGACGTTACTACGTTACGTTCACGGACGACTACTCGAGGTGGACT
CACATTGAGTTCTTATCCAACAAATCGGATGTTTTTGAAGCATACAAGCAGTTTGAAGCCTGGTGCGAGACTCAG
TTCAATTCTCGTATCAAAGTTCTCCATTCAGATCGAGGAGGGGAATATACGTCTGAAGAATTTCAGAAGTATCTC
AAATCGCGAGGAACTCAAACGAAACTTACAGTTCATGATACGCCTCAACATAACGGAGTAGCAGAACGTCGTAAT
CGAACCATCGTTGAACGTGTTCGAGCATTGTTACATGCTAGTTGTCTTCCAAAGAGCCTATGGGCTGAAGCTGCC
GCCCACATAGTATGGTTGATGAATAGAACCAGTACTAAAGCTGTTCAAGGTATGACACCTTTCGAAGCTTTGTAT
GGCCGTAAACCTCGACTCGGAAACGTTCAGGAGTGGGGTGATGAAGTTTGGGTTCACCAAGCTGGAGGGGACAAG
TTGGGAGCACGAGCAAAAAAGGGGAAATGGTTGGGATATGATACCGAGAGTAACGGCTCACGAATTTTGTTCCCT
GATACTGGGACAATCAAAATTGAGCGTAACTTTCGCTTTATCAAAGATCAGACTAACCTACAGCTCGAGGGGGAG
TATATCCCGACTCCTGAAGTACCCGCGTCGTCCACACCGGCTATTTCATCACCAGAATTGCATGAATCTACCACC
ACTCCAGTTTCACCAAGCGTTGGTAGTACCCCCACTCAACGCGAGTCGTCACCGGCACCAATTCAACAACCTGAT
TCACCGGATCAAGTACCAGTTGTTAGACGGTCACAAAGAACACGGCAGCCGAGCCAGAAAGCTCGCGAAATTCTT
GAAGGAAAAGGCATCACCGTTGTAGAAGAATTGGACTGGGAGGAAGTTCATGTATTAGTAACAGAGATGGAAATA
ATGGAGGCTTTAGAACCTCGTACCTGGAAAGAGGCCACACAGAGGACTGACTGGCCGTTGTGGAAGAAAGCGATG
GAGGAAGAATTAGCCACGTTGCAGGCTGCTGGCACCTGGGAACTAGTTGATTGTCCGCTTGGCATCAACATCGTG
GGATCAAAGTGGGTCTTCAAAGCGAAGAAGGATGCGGCAGGTAACATTGTCCGCTATAAAGCTCGTTTAGTGGCC
CAAGGTTATTCACAGATCCCAGGAGTCGACTATTTCGACACTTTTGCGCCAGTAGCGCGACTTTCGTCAATCCGA
ACCGTACTCGCTATTGCTACTGCCCGGAATCTTGAAATCCATCAAATTGATGTCAAAGGGGCGTATCTTAATGGT
ATATTAAATGATGACGAAACTGTTTACATGCGTCAACCTCCCGGTTTCCACGACACCACTCATCCCCGTTATGTC
TGTCATCTCAAAAAGACACTTTATGGTCTTAAACAGTCCGGAAGACGTTGGTATCAACGCCTTTGTGAAATTCTT
ATCGACAATCTAGGCTATTCTCGCTGTGATGTCGATCACGGTGTTTTCTTCCGTGTCATTCAAGATGATTTGATC
ATAATCCTTGTTCATGTGGACGACTGTACTCTCGTGGCAACAAAACTCGAGCTTATTAGAGAGTTGAAAGAGAGG
ATGAATGAGTTTGTAGAGGTGACTGATCTCGGAGAGATTCACTGGCTTCTAGGGATTGAAATTCGACGAAATCGA
GAGGAAGGTAAATTGTATATGTCTCAAAGGTCGTATATTGATTCGTGTCTTCGGCGATACGGTTTCGAGGATGCT
AAACCAGTCAGTATCCCTATGGATCCATCCATTCATCTTTCTACCAACCAATCACCGAATTCTACTACGGAAATT
GCTCGCATGGCACGTATTCCCTACCAAGAGGCTGTAGGTTCGCTTATGTATGCAGCAATTGCCACTCGACCTGAT
ATTGCCTTCGCAATACAAGTCCTTTCGAAATTCTCGAAGAATCCTGGAGAGAAGCATTGGGAGGCTGTAAAGAGA
GTTTTCCGGTATCTAAAAGGTACGAGAGAGTTGTGGTTGACTTTTGGAGGTCAAGACGATACTCTAAAGGGTTTT
GCTGATGCAGATGGGAATATGGCAGAGGATAGGCATGCGACTTCGGGTTTCGCCTTTATCATAAACGGAGGTGCT
GTTTCATGGAGTGCGAAACGACAAGAAATCGTCACCTTGTCGACTACTGAATCCGAATACGTGGCCGCTACACAT
GCCGCCAAAGAAACTCTATGGCTCCGTTCTCTCATTTCCCAAGTATTCAATATCACTCTCCCCACTACTCGTCTA
TTCTCGGACAATCAATCGGCTATCGCGCTGACAAAAGATCATCAATTTCATAGTCGAACAAAACATATTGACATA
CGTTATCATTTCATACGATGGATAGTCGAAGAAGGGAAAATCCGGCTTGTCTATTGTCCAACAGAGGATATGGTT
GCAGACACATTGACGAAAGCTCTACCATCTCCAAAGATTAAGCATTTCGCATGTGAGCTAGGGCTCACCACGGTT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail