Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|050950
Gene name
Locationscaffold_2:3111033..3114675
Strand+
Gene length (bp)3642
Transcript length (bp)3579
Coding sequence length (bp)3579
Protein length (aa) 1193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 5.3E-68 893 1137
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 3.2E-16 98 208
PF00665 rve Integrase core domain 3.3E-14 521 614
PF13976 gag_pre-integrs GAG-pre-integrase domain 4.7E-08 435 503

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 90 1164 2.0E-131
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 787 1146 1.0E-47
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 96 726 4.0E-44
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 385 729 1.0E-25
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 385 729 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 90 1164 2.0E-131
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 787 1146 1.0E-47
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 96 726 4.0E-44
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 385 729 1.0E-25
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 385 729 2.0E-25
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 385 729 2.0E-25
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 385 729 2.0E-25
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 385 729 2.0E-25
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 385 729 2.0E-25
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 385 729 2.0E-25
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 385 729 2.0E-25
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 385 729 2.0E-25
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 385 729 2.0E-25
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 385 729 2.0E-25
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 385 729 2.0E-25
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 385 746 1.0E-19
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 385 746 2.0E-19
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 385 746 3.0E-19
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 385 746 3.0E-19
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 385 746 3.0E-19
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 385 746 3.0E-19
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 385 746 3.0E-19
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 385 746 3.0E-19
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 385 746 3.0E-19
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 385 746 3.0E-19
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 385 746 4.0E-19
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 385 746 4.0E-19
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 385 746 4.0E-19
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 385 746 4.0E-19
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 385 746 4.0E-19
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 385 746 4.0E-19
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 385 746 5.0E-19
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 385 746 5.0E-19
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 385 746 6.0E-19
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 385 746 6.0E-19
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 385 746 6.0E-19
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 385 746 9.0E-19
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 385 746 1.0E-18
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 385 746 1.0E-18
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 385 746 1.0E-18
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 385 746 1.0E-18
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 385 746 1.0E-18
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 385 746 1.0E-18
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 385 746 1.0E-18
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 385 746 1.0E-18
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 385 746 1.0E-18
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 385 746 2.0E-18
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 880 1139 5.0E-17
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 880 1139 5.0E-17
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 880 1139 5.0E-17
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 880 1139 6.0E-17
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 880 1139 6.0E-17
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 880 1139 6.0E-17
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 880 1139 6.0E-17
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 880 1139 6.0E-17
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 880 1139 6.0E-17
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 875 1139 7.0E-17
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 875 1139 7.0E-17
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 875 1139 7.0E-17
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 875 1139 7.0E-17
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 875 1139 7.0E-17
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 875 1139 9.0E-17
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 875 1139 9.0E-17
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 905 1139 1.0E-16
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 905 1139 1.0E-16
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 880 1139 2.0E-16
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 880 1139 2.0E-16
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 880 1139 2.0E-16
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 414 740 2.0E-16
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 414 740 2.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 414 740 2.0E-16
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 875 1139 3.0E-16
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 905 1139 3.0E-16
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 905 1139 3.0E-16
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 905 1139 3.0E-16
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 877 971 3.0E-16
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 875 1139 4.0E-16
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 875 1139 4.0E-16
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 875 1139 4.0E-16
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 875 1139 4.0E-16
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 756 1139 4.0E-16
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 875 1139 5.0E-16
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 875 1139 5.0E-16
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 905 1139 6.0E-16
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 905 1139 6.0E-16
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 905 1139 7.0E-16
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 905 1139 7.0E-16
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 905 1139 8.0E-16
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 905 1139 8.0E-16
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 905 1146 1.0E-15
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 875 1139 2.0E-15
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 875 1139 2.0E-15
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 905 1139 2.0E-15
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 524 746 2.0E-15
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 972 1118 2.0E-15
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 905 1139 3.0E-15
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 905 1139 3.0E-15
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 875 1139 3.0E-15
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 864 1128 2.0E-12
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 864 1128 2.0E-12
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 456 690 8.0E-09
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 456 690 9.0E-09
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 456 690 2.0E-08
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 456 690 2.0E-07
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 456 690 2.0E-07
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 629 716 3.0E-07
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 456 690 5.0E-07
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 456 687 6.0E-06
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 489 688 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|050950
MSSTAVINDVLPPTVPALDVSGTNWAIFELRFRMVVQGKGLWGHFDGSTPRPTPPRAITPASHPSTPVLATSPST
AAAAVQVPIPSTPTPTVADIDAWDRNENIALSLLAQRIPDSTLVVVSAQTTVKLMWDKIVRDYTYKSAFSQANLR
QDFMSSRCPSGGDVRLFLNELRAKKAELLAIGVHISDDEYRSAIIQSLPRWLSTYASNQLSAARLHTSLHNTIDP
DMLIVMICDEWDRTRHFAKKGQKSEGNDALAVEEEGKGKKKGKGKGKAKDGERKKGPCWFCQGEHLKKDCAEWKK
KQEEGSNKKDQSKSSANVAEEDDDESFAVDIDKGGKISETMARVEVFDSGSSRHISPYRDMFTSLQMIQPYLPNG
DSRSQLYLKEALYAPEAGYTLVSIGRLDTDGFSTTFRDNKCIIRDSNGARVAEIPRNEKGLYKLVKSSCNEVNVA
VETLTVDALHRRLGHISSVAARKLVTSGLVSGLKLSGDESNSITCDSCSYAKATRLPIAKVREGERALNVGEEVH
TDVWGPSRVATKKGRRYYVTFTDDYSRWTHIEFLSNKSDVFEAYKWFEAWCETQFNSRIKVLHSDRGGEYTSEEF
QKYLKSRGTQTKLTVHDTPQHNGVAERRNRTIVERVRALLHASRLPKSLWAEAAAHIVWLMNRTSTKAVQGMTPF
EALYGRKPRLGNVREWGDEVWVHQAGGDKLGARAKKGKWLGYDTESNGSRILFPDTGTIKIERNFRFIKGQTDLQ
LEGEYIPTPEVPTSSAPTISSPEFPESSTTPVLPSVGGSPTQRESSPAQIQQSDSPDSDEEPVVRRSQRTRQPSQ
KAREILEGKAVSIAEDLDWEEIHALVMEVERTEALEPGNLKEAMERCDWELWKNAMKDELSMLKDAGTWELVERP
SDVNVVGSKWVYKAKKDAAGNIVRYKARLVAQGFSQVPGVDYFNTFAPVARLSSIRSVLAIATAKDLDIHQIDIK
GAYLNGKLNNDERVYMRQPPGFHDETHPTHVCHLKKTLYGLKQSGRRWYQRLCEILVDNLGFSRCDVDHGVFFKL
NQVLIIVLVHVDDCTIISTKLDAIKWLKERMNEFVEVTDLGEIHWLLGIEIKRDRGIGKLSLSQRSYIDASLRRY
GFEDAKPLSIPMDPTIHLSSDHSPKSTTEVARMARLPYSDGQNRCNVFNTFKDTIIACDKLTVTSHN*
Coding >AgabiH97|050950
ATGTCAAGTACAGCAGTTATAAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCGATATTCGAGTTGCGTTTCCGGATGGTTGTCCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGATATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTTTAGCTCAGCGAATTCCTGACTCCACACTCGTAGTGGTTTCTGCTCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCACGTTGCCCAAGTGGAGGTGACGTACGCTTGTTCTTAAATGAGTTACGAGCTAAAAAG
GCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCGT
TGGTTGTCGACATATGCTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCT
GATATGCTCATCGTTATGATTTGCGACGAATGGGACCGTACTCGACATTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCATTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAGGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAATAAGAAAGACCAATCTAAATCGAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGATTTCCGAGACCATGGCCCGAGTTGAAGTTTTCGATTCCGGA
TCCTCTCGACATATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTACTTGCCCAATGGT
GATTCACGATCCCAACTATATCTTAAAGAAGCACTGTATGCACCTGAAGCTGGTTATACTCTCGTTTCTATTGGT
CGTCTGGACACCGACGGTTTTTCCACGACGTTCAGGGATAATAAATGCATAATTCGAGACTCGAATGGTGCTCGT
GTCGCCGAAATTCCTAGAAATGAGAAGGGGCTATATAAATTGGTCAAGTCCAGCTGCAATGAAGTAAATGTAGCA
GTTGAAACCCTTACCGTTGATGCACTACATCGTCGTCTTGGTCATATATCATCTGTGGCCGCTCGAAAACTTGTT
ACGAGTGGACTAGTATCTGGACTAAAGTTGAGCGGAGATGAATCTAACTCGATTACCTGTGATTCATGCTCATAT
GCCAAAGCTACACGCTTGCCGATAGCGAAAGTTCGTGAAGGTGAAAGAGCGTTGAATGTTGGCGAGGAAGTTCAT
ACGGATGTATGGGGACCATCCAGAGTTGCGACAAAGAAAGGACGACGTTACTACGTTACGTTCACGGACGACTAC
TCGAGGTGGACTCACATTGAGTTCTTATCCAACAAATCGGATGTTTTTGAAGCGTACAAGTGGTTTGAAGCCTGG
TGCGAGACTCAGTTCAATTCTCGTATCAAAGTTCTCCATTCAGATCGAGGAGGGGAATATACGTCTGAAGAATTT
CAGAAGTATCTCAAATCGCGAGGAACTCAAACAAAACTTACAGTTCATGATACGCCTCAACATAACGGAGTAGCA
GAACGACGTAATCGAACCATCGTTGAACGCGTTCGAGCATTGTTACATGCTAGTCGTCTTCCTAAGAGCCTATGG
GCTGAGGCCGCCGCCCACATAGTATGGTTGATGAATAGAACCAGTACTAAAGCTGTTCAAGGTATGACACCTTTC
GAAGCTTTGTATGGCCGTAAACCTCGACTCGGAAACGTTCGGGAGTGGGGTGATGAAGTTTGGGTTCACCAAGCT
GGAGGGGATAAATTGGGTGCACGAGCGAAAAAGGGGAAATGGTTGGGATATGATACTGAGAGTAACGGCTCAAGA
ATCTTGTTTCCTGATACCGGGACAATCAAAATTGAGCGTAACTTTCGTTTTATCAAAGGACAAACTGACCTTCAG
CTCGAGGGGGAGTATATCCCGACTCCCGAAGTACCCACGTCATCCGCACCGACTATTTCATCACCAGAATTTCCT
GAATCTTCCACCACTCCAGTTTTGCCTAGCGTTGGTGGTTCCCCCACTCAACGTGAATCGTCACCGGCACAAATC
CAACAATCTGATTCACCAGACTCGGATGAAGAACCGGTTGTTAGGCGATCGCAAAGGACACGTCAGCCCAGTCAA
AAGGCTCGTGAGATTCTAGAAGGGAAAGCAGTTAGCATAGCTGAAGACTTGGATTGGGAAGAAATACATGCCTTG
GTCATGGAAGTTGAAAGAACGGAAGCGTTGGAACCAGGAAATTTGAAAGAAGCCATGGAAAGATGTGATTGGGAG
CTGTGGAAGAATGCGATGAAGGATGAGCTGTCAATGCTGAAAGATGCTGGCACGTGGGAATTAGTTGAACGTCCA
TCAGACGTCAACGTCGTTGGATCAAAGTGGGTTTATAAAGCCAAAAAGGATGCCGCAGGAAACATCGTGCGTTAT
AAAGCTCGTTTAGTGGCCCAGGGTTTCTCCCAAGTACCCGGAGTTGATTACTTCAACACGTTTGCCCCCGTAGCT
CGCCTCTCATCAATTCGCTCGGTTCTTGCCATCGCTACTGCTAAAGATCTAGATATCCATCAGATCGACATCAAG
GGAGCCTACCTTAACGGGAAACTCAACAATGATGAACGTGTCTACATGAGGCAGCCACCTGGCTTTCACGACGAA
ACCCATCCCACCCATGTCTGTCATCTCAAGAAAACGCTTTACGGTCTCAAACAATCTGGTAGACGTTGGTATCAA
CGTTTATGCGAAATTCTTGTTGATAATTTAGGTTTTTCGCGATGTGACGTCGACCACGGTGTTTTCTTCAAGCTT
AACCAAGTTTTGATCATCGTACTTGTTCATGTCGATGACTGTACGATCATATCGACAAAACTAGATGCTATCAAG
TGGCTAAAGGAGCGGATGAATGAGTTCGTTGAGGTTACGGATCTGGGAGAAATTCATTGGCTATTGGGAATTGAG
ATCAAAAGGGACCGTGGTATAGGCAAGTTATCCCTTTCGCAACGGTCATACATTGATGCGTCGCTTCGACGATAT
GGTTTTGAGGACGCTAAGCCCCTTAGTATCCCCATGGATCCCACCATACATCTTTCATCCGATCATTCACCTAAA
TCAACCACCGAAGTGGCTCGTATGGCTCGATTACCATACAGTGACGGACAAAACCGTTGCAATGTTTTTAACACC
TTCAAAGATACTATTATAGCATGTGACAAACTGACCGTGACATCACATAATTAA
Transcript >AgabiH97|050950
ATGTCAAGTACAGCAGTTATAAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCGATATTCGAGTTGCGTTTCCGGATGGTTGTCCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGATATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTTTAGCTCAGCGAATTCCTGACTCCACACTCGTAGTGGTTTCTGCTCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCACGTTGCCCAAGTGGAGGTGACGTACGCTTGTTCTTAAATGAGTTACGAGCTAAAAAG
GCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCGT
TGGTTGTCGACATATGCTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCT
GATATGCTCATCGTTATGATTTGCGACGAATGGGACCGTACTCGACATTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCATTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAGGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAATAAGAAAGACCAATCTAAATCGAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGATTTCCGAGACCATGGCCCGAGTTGAAGTTTTCGATTCCGGA
TCCTCTCGACATATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTACTTGCCCAATGGT
GATTCACGATCCCAACTATATCTTAAAGAAGCACTGTATGCACCTGAAGCTGGTTATACTCTCGTTTCTATTGGT
CGTCTGGACACCGACGGTTTTTCCACGACGTTCAGGGATAATAAATGCATAATTCGAGACTCGAATGGTGCTCGT
GTCGCCGAAATTCCTAGAAATGAGAAGGGGCTATATAAATTGGTCAAGTCCAGCTGCAATGAAGTAAATGTAGCA
GTTGAAACCCTTACCGTTGATGCACTACATCGTCGTCTTGGTCATATATCATCTGTGGCCGCTCGAAAACTTGTT
ACGAGTGGACTAGTATCTGGACTAAAGTTGAGCGGAGATGAATCTAACTCGATTACCTGTGATTCATGCTCATAT
GCCAAAGCTACACGCTTGCCGATAGCGAAAGTTCGTGAAGGTGAAAGAGCGTTGAATGTTGGCGAGGAAGTTCAT
ACGGATGTATGGGGACCATCCAGAGTTGCGACAAAGAAAGGACGACGTTACTACGTTACGTTCACGGACGACTAC
TCGAGGTGGACTCACATTGAGTTCTTATCCAACAAATCGGATGTTTTTGAAGCGTACAAGTGGTTTGAAGCCTGG
TGCGAGACTCAGTTCAATTCTCGTATCAAAGTTCTCCATTCAGATCGAGGAGGGGAATATACGTCTGAAGAATTT
CAGAAGTATCTCAAATCGCGAGGAACTCAAACAAAACTTACAGTTCATGATACGCCTCAACATAACGGAGTAGCA
GAACGACGTAATCGAACCATCGTTGAACGCGTTCGAGCATTGTTACATGCTAGTCGTCTTCCTAAGAGCCTATGG
GCTGAGGCCGCCGCCCACATAGTATGGTTGATGAATAGAACCAGTACTAAAGCTGTTCAAGGTATGACACCTTTC
GAAGCTTTGTATGGCCGTAAACCTCGACTCGGAAACGTTCGGGAGTGGGGTGATGAAGTTTGGGTTCACCAAGCT
GGAGGGGATAAATTGGGTGCACGAGCGAAAAAGGGGAAATGGTTGGGATATGATACTGAGAGTAACGGCTCAAGA
ATCTTGTTTCCTGATACCGGGACAATCAAAATTGAGCGTAACTTTCGTTTTATCAAAGGACAAACTGACCTTCAG
CTCGAGGGGGAGTATATCCCGACTCCCGAAGTACCCACGTCATCCGCACCGACTATTTCATCACCAGAATTTCCT
GAATCTTCCACCACTCCAGTTTTGCCTAGCGTTGGTGGTTCCCCCACTCAACGTGAATCGTCACCGGCACAAATC
CAACAATCTGATTCACCAGACTCGGATGAAGAACCGGTTGTTAGGCGATCGCAAAGGACACGTCAGCCCAGTCAA
AAGGCTCGTGAGATTCTAGAAGGGAAAGCAGTTAGCATAGCTGAAGACTTGGATTGGGAAGAAATACATGCCTTG
GTCATGGAAGTTGAAAGAACGGAAGCGTTGGAACCAGGAAATTTGAAAGAAGCCATGGAAAGATGTGATTGGGAG
CTGTGGAAGAATGCGATGAAGGATGAGCTGTCAATGCTGAAAGATGCTGGCACGTGGGAATTAGTTGAACGTCCA
TCAGACGTCAACGTCGTTGGATCAAAGTGGGTTTATAAAGCCAAAAAGGATGCCGCAGGAAACATCGTGCGTTAT
AAAGCTCGTTTAGTGGCCCAGGGTTTCTCCCAAGTACCCGGAGTTGATTACTTCAACACGTTTGCCCCCGTAGCT
CGCCTCTCATCAATTCGCTCGGTTCTTGCCATCGCTACTGCTAAAGATCTAGATATCCATCAGATCGACATCAAG
GGAGCCTACCTTAACGGGAAACTCAACAATGATGAACGTGTCTACATGAGGCAGCCACCTGGCTTTCACGACGAA
ACCCATCCCACCCATGTCTGTCATCTCAAGAAAACGCTTTACGGTCTCAAACAATCTGGTAGACGTTGGTATCAA
CGTTTATGCGAAATTCTTGTTGATAATTTAGGTTTTTCGCGATGTGACGTCGACCACGGTGTTTTCTTCAAGCTT
AACCAAGTTTTGATCATCGTACTTGTTCATGTCGATGACTGTACGATCATATCGACAAAACTAGATGCTATCAAG
TGGCTAAAGGAGCGGATGAATGAGTTCGTTGAGGTTACGGATCTGGGAGAAATTCATTGGCTATTGGGAATTGAG
ATCAAAAGGGACCGTGGTATAGGCAAGTTATCCCTTTCGCAACGGTCATACATTGATGCGTCGCTTCGACGATAT
GGTTTTGAGGACGCTAAGCCCCTTAGTATCCCCATGGATCCCACCATACATCTTTCATCCGATCATTCACCTAAA
TCAACCACCGAAGTGGCTCGTATGGCTCGATTACCATACAGTGACGGACAAAACCGTTGCAATGTTTTTAACACC
TTCAAAGATACTATTATAGCATGTGACAAACTGACCGTGACATCACATAATTAA
Gene >AgabiH97|050950
ATGTCAAGTACAGCAGTTATAAACGACGTATTGCCACCCACCGTGCCTGCATTGGATGTTTCCGGAACGAATTGG
GCGATATTCGAGTTGCGTTTCCGGATGGTTGTCCAAGGGAAGGGCTTGTGGGGTCATTTCGACGGTTCAACTCCT
CGTCCTACACCACCGCGAGCTATCACTCCGGCGTCGCACCCATCTACTCCAGTCCTAGCTACTTCTCCTTCAACC
GCAGCTGCGGCTGTACAAGTTCCTATTCCTTCGACTCCTACACCAACAGTGGCCGATATTGATGCCTGGGATCGT
AACGAAAATATTGCGCTATCGCTTTTAGCTCAGCGAATTCCTGACTCCACACTCGTAGTGGTTTCTGCTCAAACT
ACTGTCAAACTGATGTGGGACAAAATAGTTCGAGACTATACGTACAAAAGTGCTTTCTCTCAAGCAAACCTTCGC
CAAGACTTCATGTCTTCACGTTGCCCAAGTGGAGGTGACGTACGCTTGTTCTTAAATGAGTTACGAGCTAAAAAG
GCGGAGCTACTCGCTATTGGTGTCCACATTAGTGATGATGAGTATCGAAGTGCAATAATTCAATCCCTACCTCGT
TGGTTGTCGACATATGCTTCAAATCAACTCTCAGCAGCTCGTCTCCATACTTCTCTTCACAACACTATTGATCCT
GATATGCTCATCGTTATGATTTGCGACGAATGGGACCGTACTCGACATTTCGCCAAGAAAGGTCAAAAATCTGAA
GGGAATGATGCATTAGCCGTTGAAGAGGAAGGAAAAGGAAAGAAGAAGGGGAAAGGGAAAGGGAAAGCTAAAGAT
GGCGAGAGGAAGAAAGGACCATGTTGGTTTTGCCAAGGCGAGCATTTGAAAAAGGATTGTGCGGAATGGAAGAAG
AAACAAGAGGAAGGGTCTAATAAGAAAGACCAATCTAAATCGAGTGCAAATGTAGCTGAAGAAGATGATGACGAG
TCTTTTGCAGTAGACATAGATAAAGGGGGAAAGATTTCCGAGACCATGGCCCGAGTTGAAGTTTTCGATTCCGGA
TCCTCTCGACATATTTCTCCTTATCGAGATATGTTTACTTCGCTTCAAATGATCCAACCCTGTGCGTTGTGAACA
GCAAATCAGCAATGCCTAAACGCAATCGGGAAGGGAGAAATCAAACTAGACTTGCCCAATGGTGATTCACGATCC
CAACTATATCTTAAAGAAGCACTGTATGCACCTGAAGCTGGTTATACTCTCGTTTCTATTGGTCGTCTGGACACC
GACGGTTTTTCCACGACGTTCAGGGATAATAAATGCATAATTCGAGACTCGAATGGTGCTCGTGTCGCCGAAATT
CCTAGAAATGAGAAGGGGCTATATAAATTGGTCAAGTCCAGCTGCAATGAAGTAAATGTAGCAGTTGAAACCCTT
ACCGTTGATGCACTACATCGTCGTCTTGGTCATATATCATCTGTGGCCGCTCGAAAACTTGTTACGAGTGGACTA
GTATCTGGACTAAAGTTGAGCGGAGATGAATCTAACTCGATTACCTGTGATTCATGCTCATATGCCAAAGCTACA
CGCTTGCCGATAGCGAAAGTTCGTGAAGGTGAAAGAGCGTTGAATGTTGGCGAGGAAGTTCATACGGATGTATGG
GGACCATCCAGAGTTGCGACAAAGAAAGGACGACGTTACTACGTTACGTTCACGGACGACTACTCGAGGTGGACT
CACATTGAGTTCTTATCCAACAAATCGGATGTTTTTGAAGCGTACAAGTGGTTTGAAGCCTGGTGCGAGACTCAG
TTCAATTCTCGTATCAAAGTTCTCCATTCAGATCGAGGAGGGGAATATACGTCTGAAGAATTTCAGAAGTATCTC
AAATCGCGAGGAACTCAAACAAAACTTACAGTTCATGATACGCCTCAACATAACGGAGTAGCAGAACGACGTAAT
CGAACCATCGTTGAACGCGTTCGAGCATTGTTACATGCTAGTCGTCTTCCTAAGAGCCTATGGGCTGAGGCCGCC
GCCCACATAGTATGGTTGATGAATAGAACCAGTACTAAAGCTGTTCAAGGTATGACACCTTTCGAAGCTTTGTAT
GGCCGTAAACCTCGACTCGGAAACGTTCGGGAGTGGGGTGATGAAGTTTGGGTTCACCAAGCTGGAGGGGATAAA
TTGGGTGCACGAGCGAAAAAGGGGAAATGGTTGGGATATGATACTGAGAGTAACGGCTCAAGAATCTTGTTTCCT
GATACCGGGACAATCAAAATTGAGCGTAACTTTCGTTTTATCAAAGGACAAACTGACCTTCAGCTCGAGGGGGAG
TATATCCCGACTCCCGAAGTACCCACGTCATCCGCACCGACTATTTCATCACCAGAATTTCCTGAATCTTCCACC
ACTCCAGTTTTGCCTAGCGTTGGTGGTTCCCCCACTCAACGTGAATCGTCACCGGCACAAATCCAACAATCTGAT
TCACCAGACTCGGATGAAGAACCGGTTGTTAGGCGATCGCAAAGGACACGTCAGCCCAGTCAAAAGGCTCGTGAG
ATTCTAGAAGGGAAAGCAGTTAGCATAGCTGAAGACTTGGATTGGGAAGAAATACATGCCTTGGTCATGGAAGTT
GAAAGAACGGAAGCGTTGGAACCAGGAAATTTGAAAGAAGCCATGGAAAGATGTGATTGGGAGCTGTGGAAGAAT
GCGATGAAGGATGAGCTGTCAATGCTGAAAGATGCTGGCACGTGGGAATTAGTTGAACGTCCATCAGACGTCAAC
GTCGTTGGATCAAAGTGGGTTTATAAAGCCAAAAAGGATGCCGCAGGAAACATCGTGCGTTATAAAGCTCGTTTA
GTGGCCCAGGGTTTCTCCCAAGTACCCGGAGTTGATTACTTCAACACGTTTGCCCCCGTAGCTCGCCTCTCATCA
ATTCGCTCGGTTCTTGCCATCGCTACTGCTAAAGATCTAGATATCCATCAGATCGACATCAAGGGAGCCTACCTT
AACGGGAAACTCAACAATGATGAACGTGTCTACATGAGGCAGCCACCTGGCTTTCACGACGAAACCCATCCCACC
CATGTCTGTCATCTCAAGAAAACGCTTTACGGTCTCAAACAATCTGGTAGACGTTGGTATCAACGTTTATGCGAA
ATTCTTGTTGATAATTTAGGTTTTTCGCGATGTGACGTCGACCACGGTGTTTTCTTCAAGCTTAACCAAGTTTTG
ATCATCGTACTTGTTCATGTCGATGACTGTACGATCATATCGACAAAACTAGATGCTATCAAGTGGCTAAAGGAG
CGGATGAATGAGTTCGTTGAGGTTACGGATCTGGGAGAAATTCATTGGCTATTGGGAATTGAGATCAAAAGGGAC
CGTGGTATAGGCAAGTTATCCCTTTCGCAACGGTCATACATTGATGCGTCGCTTCGACGATATGGTTTTGAGGAC
GCTAAGCCCCTTAGTATCCCCATGGATCCCACCATACATCTTTCATCCGATCATTCACCTAAATCAACCACCGAA
GTGGCTCGTATGGCTCGATTACCATACAGTGACGGACAAAACCGTTGCAATGTTTTTAACACCTTCAAAGATACT
ATTATAGCATGTGACAAACTGACCGTGACATCACATAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail