Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|050630
Gene name
Locationscaffold_2:3001883..3004082
Strand-
Gene length (bp)2199
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 9.2E-14 10 303
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.3E-15 5 78

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 526 548 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|050630
MKIAVIGSGVSGLAATWLLNEHSDHEVHLYEADDRPGGHANTVRFRPRDQLQGDGVDVDTGFIVFNPPTYPNFLR
FLELYPPYEDQPLKSSSPLLLDPALAPNKGIRILQTEMSFSVSRDAGTFEWAGKKDPLAFFCQRARVFDPNMWRM
LYDVLRFNTCAPQIITKNDHAEISIGQYLDQEGYSDAFRDNYLMPMAAAVWSTPPDKCFDEFPAHTLIKFMYNHS
LLQMVGKPKWMTICGGSHHYVNQILQRLPESQLHLSSKINCVSSVPSKNSGPTLELVTDNDEKYLYDHVIFACHS
DDALRILQAGDGFEEDEARILESFEWNKNEVLLHSDTRLMPRSRRAWSSWNFLAFSEGSHKANIDRVSLHFNHDK
YGPVLATLNPPPHIQVDEDKIQGRWSYDHPVIDDKAVKAQQEMYKIQNKRSISYAGAYLKYGFHEDGFTSGLLAA
CSVEDKDLYERVHKQFSSDSGVVENGNRVIHTKNATVRPPFAIEHADHHLFFRQSVMDKVFAGMFRVLEASGSRK
VIGAFGSLTLTVCGFLVIWPASLFLRMIGRNVYGNDKKRI*
Coding >AgabiH97|050630
ATGAAAATTGCTGTCATTGGGTCCGGAGTCTCGGGGCTCGCTGCAACTTGGCTTTTGAATGAACACAGTGACCAT
GAGGTGCATCTTTATGAAGCGGACGACAGACCTGGTGGTCATGCAAACACGGTCAGGTTTCGGCCCAGAGACCAA
CTTCAAGGGGATGGTGTGGACGTCGATACTGGTTTTATCGTTTTCAACCCACCGACATACCCCAATTTCTTACGT
TTCCTCGAACTTTATCCCCCTTATGAAGATCAACCGCTGAAGTCATCCTCGCCATTGTTGCTTGATCCTGCTTTG
GCACCAAACAAAGGCATTCGTATCCTACAGACAGAAATGTCTTTCAGTGTTTCTCGAGACGCTGGTACTTTCGAA
TGGGCAGGGAAGAAAGACCCACTTGCGTTTTTCTGTCAGCGCGCCCGCGTTTTTGATCCGAATATGTGGCGAATG
CTTTACGACGTCTTGCGGTTTAACACTTGTGCCCCTCAAATAATCACAAAAAATGACCACGCTGAGATCAGTATT
GGCCAATATCTTGATCAAGAAGGGTATTCGGATGCCTTCCGAGATAATTATTTGATGCCAATGGCTGCGGCTGTC
TGGAGTACTCCACCAGATAAGTGCTTCGACGAATTCCCAGCTCATACCCTTATCAAATTCATGTATAACCACAGT
CTCCTTCAGATGGTTGGTAAACCGAAGTGGATGACCATCTGTGGTGGCAGTCATCACTACGTAAATCAAATTCTA
CAACGCCTACCCGAGTCCCAGCTACACTTGTCGAGTAAGATCAACTGCGTTTCCTCAGTACCCTCAAAAAACTCT
GGCCCTACGCTTGAGCTAGTTACAGATAACGACGAAAAGTATCTTTACGATCACGTTATTTTTGCCTGTCATTCG
GATGACGCTCTGCGAATACTTCAAGCAGGGGATGGTTTCGAAGAAGATGAAGCACGTATCCTTGAATCTTTCGAG
TGGAACAAAAACGAAGTCTTACTCCACAGCGATACACGCCTCATGCCTAGAAGTCGCCGAGCTTGGTCGAGTTGG
AACTTCCTAGCATTTTCAGAGGGTTCTCACAAAGCCAATATAGATCGCGTTTCTCTTCACTTTAATCATGATAAA
TACGGTCCCGTGCTTGCCACTCTCAACCCTCCACCGCATATACAAGTAGACGAGGACAAAATACAAGGAAGATGG
AGTTATGACCATCCTGTAATCGACGACAAGGCCGTTAAAGCTCAGCAAGAAATGTACAAAATTCAAAATAAGCGC
TCCATTTCATACGCAGGCGCATACTTGAAGTACGGCTTCCATGAGGACGGCTTCACATCTGGACTATTAGCTGCT
TGTTCAGTTGAAGACAAAGACTTATACGAGCGGGTTCACAAACAATTCTCATCAGATAGCGGAGTTGTTGAAAAC
GGAAACAGAGTCATTCACACCAAAAACGCAACCGTCAGACCTCCTTTCGCTATCGAACATGCTGATCACCATTTA
TTTTTTCGACAAAGCGTGATGGACAAAGTTTTCGCGGGTATGTTTAGGGTGTTGGAGGCTTCTGGGTCGAGGAAA
GTGATCGGGGCTTTTGGAAGTCTGACTTTGACCGTTTGTGGATTTCTTGTTATTTGGCCAGCTTCCCTCTTTTTG
CGAATGATTGGGCGGAATGTGTATGGGAATGATAAGAAGAGGATCTGA
Transcript >AgabiH97|050630
ATGAAAATTGCTGTCATTGGGTCCGGAGTCTCGGGGCTCGCTGCAACTTGGCTTTTGAATGAACACAGTGACCAT
GAGGTGCATCTTTATGAAGCGGACGACAGACCTGGTGGTCATGCAAACACGGTCAGGTTTCGGCCCAGAGACCAA
CTTCAAGGGGATGGTGTGGACGTCGATACTGGTTTTATCGTTTTCAACCCACCGACATACCCCAATTTCTTACGT
TTCCTCGAACTTTATCCCCCTTATGAAGATCAACCGCTGAAGTCATCCTCGCCATTGTTGCTTGATCCTGCTTTG
GCACCAAACAAAGGCATTCGTATCCTACAGACAGAAATGTCTTTCAGTGTTTCTCGAGACGCTGGTACTTTCGAA
TGGGCAGGGAAGAAAGACCCACTTGCGTTTTTCTGTCAGCGCGCCCGCGTTTTTGATCCGAATATGTGGCGAATG
CTTTACGACGTCTTGCGGTTTAACACTTGTGCCCCTCAAATAATCACAAAAAATGACCACGCTGAGATCAGTATT
GGCCAATATCTTGATCAAGAAGGGTATTCGGATGCCTTCCGAGATAATTATTTGATGCCAATGGCTGCGGCTGTC
TGGAGTACTCCACCAGATAAGTGCTTCGACGAATTCCCAGCTCATACCCTTATCAAATTCATGTATAACCACAGT
CTCCTTCAGATGGTTGGTAAACCGAAGTGGATGACCATCTGTGGTGGCAGTCATCACTACGTAAATCAAATTCTA
CAACGCCTACCCGAGTCCCAGCTACACTTGTCGAGTAAGATCAACTGCGTTTCCTCAGTACCCTCAAAAAACTCT
GGCCCTACGCTTGAGCTAGTTACAGATAACGACGAAAAGTATCTTTACGATCACGTTATTTTTGCCTGTCATTCG
GATGACGCTCTGCGAATACTTCAAGCAGGGGATGGTTTCGAAGAAGATGAAGCACGTATCCTTGAATCTTTCGAG
TGGAACAAAAACGAAGTCTTACTCCACAGCGATACACGCCTCATGCCTAGAAGTCGCCGAGCTTGGTCGAGTTGG
AACTTCCTAGCATTTTCAGAGGGTTCTCACAAAGCCAATATAGATCGCGTTTCTCTTCACTTTAATCATGATAAA
TACGGTCCCGTGCTTGCCACTCTCAACCCTCCACCGCATATACAAGTAGACGAGGACAAAATACAAGGAAGATGG
AGTTATGACCATCCTGTAATCGACGACAAGGCCGTTAAAGCTCAGCAAGAAATGTACAAAATTCAAAATAAGCGC
TCCATTTCATACGCAGGCGCATACTTGAAGTACGGCTTCCATGAGGACGGCTTCACATCTGGACTATTAGCTGCT
TGTTCAGTTGAAGACAAAGACTTATACGAGCGGGTTCACAAACAATTCTCATCAGATAGCGGAGTTGTTGAAAAC
GGAAACAGAGTCATTCACACCAAAAACGCAACCGTCAGACCTCCTTTCGCTATCGAACATGCTGATCACCATTTA
TTTTTTCGACAAAGCGTGATGGACAAAGTTTTCGCGGGTATGTTTAGGGTGTTGGAGGCTTCTGGGTCGAGGAAA
GTGATCGGGGCTTTTGGAAGTCTGACTTTGACCGTTTGTGGATTTCTTGTTATTTGGCCAGCTTCCCTCTTTTTG
CGAATGATTGGGCGGAATGTGTATGGGAATGATAAGAAGAGGATCTGA
Gene >AgabiH97|050630
ATGAAAATTGCTGTCATTGGGTCCGGAGTCTCGGGGCTCGCTGCAACTTGGCTTTTGAATGAACACAGTGACCAT
GAGGTGCATCTTTATGAAGCGGACGACAGACCTGGTGGTCATGCAAACACGGTCAGGTTTCGGCCCAGAGACCAA
CTTCAAGGGGATGGTGTGGACGTCGATACGTAGGTTCCAATATTCCATCCAAATGTCATTCTACTAAGACCGGTC
ACAGTGGTTTTGTACGCGTTTGAAATCTTTTCCTTTAAAACGCATGTAACACGTTCATAAACAATATTTCAGATC
GTTTTCAACCCACCGACATACCCCAATTTCTTACGTTTCCTCGAACTTTATCCCCCTTATGAAGATCAACCGCTG
AAGTCATCCTCGCCATTGTTGCTTGATCCTGCTTTGGCACCAAACAAAGGCATTCGTATCCTACAGACAGAAATG
TCTTTCAGTGTTTCTCGAGACGCTGGTACTTTCGAATGGGCAGGGAAGAAAGACCCACTTGCGTTTTTCTGTCAG
CGCGCCCGCGTTTTTGATCCGAATATGTGGCGAATGCTTTACGACGTCTTGCGGTTTAACACTTGTGCCCCTCAA
ATAATCACAAAAAATGACCACGCTGAGATCAGTATTGGCCAATATCTTGATCAAGAAGGGTATTCGGATGCCTTC
CGAGATAATTATTTGATGGTCTGTTGTTTAGCAGGATAGTCAGTCCTTTGATTGACGTATTTTCTTTGCCAGCCA
ATGGCTGCGGCTGTCTGGAGTACTCCACCAGATAAGTGCTTCGACGAATTCCCAGCTCATACCCTTGTATGCTCT
CTATATCGTTATTTTATTCAACACAAACTAATCATATCAAAACTAGATCAAATTCATGTATAACCACAGTCTCCT
TCAGATGGTTGGTAAACCGAAGTGGATGACCATCTGTGGTGGCAGGTCCGTTTTTCCATATATCATCGCGTTTTC
ATGCCGATAACAAACTTTTCTAGTCATCACTACGTAAATCAAATTCTACAACGCCTACCCGAGTCCCAGCTACAC
TTGTCGAGTAAGATCAACTGCGTTTCCTCAGTACCCTCAAAAAACTCTGGCCCTACGCTTGAGCTAGTTACAGAT
AACGACGAAAAGTATCTTTACGATCACGTTATTTTTGCCTGTCATTCGGATGACGCTCTGCGAATACTTCAAGCA
GGGGATGGTTTCGAAGAAGATGAAGCACGTATCCTTGAATCTTTCGAGTGGAACAAAAACGAAGTCTTACTCCAC
AGCGATACACGCGTTCGTTCGTCTCCTACTGGAATGTATTCTTTAACTTAGAAATATCCAGCTCATGCCTAGAAG
TCGCCGAGCTTGGTCGAGTTGGAACTTCCTAGCATTTTCAGAGGGTTCTCACAAAGCCAATATAGATCGCGTTTC
TCTGTAAGCCCTCTGTTAAACCACATTTAACTGCATCTGACGCGTTTTAGGACTTGTTAGTCACTTTAATCATGG
TACTTTTTCAAGTTTTCTGACGTCCTAATCATCCAGATGGCATGAACGACTTACAGCACATACCTGAAGATAAAT
ACGGTCCCGTGCTTGCCACTCTCAACCCTCCACCGCATATACAAGTAGACGAGGACAAAATACAAGGAAGATGGA
GTTATGACCATCCTGTAATCGACGACAAGGTACGAAATGTACATTTCGCCATGTGTTTCGAGTGCTGACACCCTG
TTGTAGGCCGTTAAAGCTCAGCAAGAAATGTACAAAATTCAAAATAAGCGCTCCATTTCATACGCAGGCGCATAC
TTGAAGTACGGCTTCCATGAGGACGGCTTCACATCTGGACTATTAGCTGCTTGTTCAGTTGAAGACAAAGACTTA
TACGAGCGGGTTCACAAACAATTCTCATCAGATAGCGGAGTTGTTGAAAACGGAAACAGAGTCATTCACACCAAA
AACGCAACCGTCAGACCTCCTTTCGCTATCGAACATGCTGATCACCATTTATTTTTTCGACAAAGCGTGATGGAC
AAAGTTTTCGCGGGTATGTTTAGGGTGTTGGAGGCTTCTGGGTCGAGGAAAGTGATCGGGGCTTTTGGAAGTCTG
ACTTTGACCGTTTGTGGATTTCTTGTTATTTGGCCAGCTTCCCTCTTTTTGCGAATGATTGGGCGGAATGTGTAT
GGGAATGATAAGAAGAGGATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail