Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|050440
Gene name
Locationscaffold_2:2945117..2954416
Strand+
Gene length (bp)9299
Transcript length (bp)7929
Coding sequence length (bp)7929
Protein length (aa) 2643

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12074 Gcn1_N Generalcontrol nonderepressible 1 (Gcn1) N-terminal 9.7E-93 480 831

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn1 PE=3 SV=1 238 2551 0.0E+00
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 770 2548 0.0E+00
sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens GN=GCN1L1 PE=1 SV=6 785 2542 0.0E+00
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium discoideum GN=gcn1l1 PE=3 SV=1 788 2533 0.0E+00
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 1545 1781 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn1 PE=3 SV=1 238 2551 0.0E+00
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 770 2548 0.0E+00
sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens GN=GCN1L1 PE=1 SV=6 785 2542 0.0E+00
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium discoideum GN=gcn1l1 PE=3 SV=1 788 2533 0.0E+00
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 1545 1781 4.0E-28
sp|P25997|EF3_CANAL Elongation factor 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF3 PE=1 SV=2 1545 1788 4.0E-26
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 1539 1781 4.0E-26
sp|P53978|EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEF3 PE=1 SV=2 1467 1788 2.0E-24
sp|O93796|EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEF3 PE=3 SV=2 1545 1788 1.0E-21
sp|Q75EV6|EF3_ASHGO Elongation factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF3 PE=3 SV=2 1545 1788 3.0E-21
sp|P16521|EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF3 PE=1 SV=4 1545 1788 5.0E-21
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 1504 1774 1.0E-17
sp|Q08972|NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEW1 PE=1 SV=1 1545 1848 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|050440
MSSEPAPKLSHDRNLHHRVCKSPNSTSANGVHKRENPQKHLPRANLPSSRKPTFAKLKKQEAKAGSTGASLTSFD
ITSWAAQSSTAAIMDENEGVYGVENVWAKERVLQDWNASVEHARTKLLVEKVKGRIAFLQEDILGIVRSVDLSLS
QIMDVFQFLMLTYPRYGDDKSQAAVESVGMELISQDEQREIKLGVSEQIIGWLSNEVGRYAKRNSADSYAPADLF
VLLNWACGIYTVCVKWNENFPTSPAFKALVGSLALLLDMVLESSKSKDTLKRGSLVRTRRALRSSGSTTPVVIST
LLELVKAPTSQNPSRFLTLIGVATAVLVRQKHVPTSPEERLPEQLQTEISNIYTSMILMSRAVTPPHILTSFEDF
IATYITPDSLVSNYLPAMEKALLRSPEYALPTLTSFFQYYRHLLDESTFHRILTQIISCSKSSNAAVRISAIGLF
KIMQGSTSTHGVIAVNNLLALPKSGKSTGPENRIALYSMLAFLQPGTEVSSTLVEAAIPLLAKEQNEVATAKLAT
SLGPHITFLLKFDTDKLKDVTPLIVKDMNSAKPAVRRAFVALAGDIFYEENSVSLEDEKAVVFMKVLLSAFETSL
KNVSGNVLNNPAGPLEGYIAVAVLLGPLHHLGRFDDVISKNAVIGAIATSTVKPSFLLWEKVYQKATEEVDEMWL
LRALKVSLRYFKKELVKNEVLRINFGSALLHLAVESTRKDTRQATNKMISEAAVWDPHLTTTLIRESVVASLCRA
SSTKTTTGEDAPALKKHSRLASVLLSSNTYDGDVDMELKEELVTELIVVGHHEFVSGPLRQTWIDICQKANIDPK
ALIEKHVDKLLKLVLESTTVEAKFGFAEAAYHAVTTLTFIAPSAILPRIVDQIALDLESSLLNSLTDFDYGVWQT
PEGEAFVDVLASNQDTPKVVKGKGAQLAKWDEEVRKSLANKKGNAPTLTKQQQALIATQLEKERGVRERVIGIKA
QVDRGLALVKSVVDASVEEFPPYIAPLTKLMLDGVLKNGKALVGQEAFNIYLELARCCSGRLDTFRKWLGIATLR
SLKIDSIPEELMAESLHNLIVRVLYRLRSLAEQAPFDASTFSYVFPLLEQIIQQGGIAMEEEDEPLEQVALTLDF
IKFHCGEFTDAAFPRKLTMQQLVHIIRHQPKLSKNASSTLIDLGEAISPTAVREEIYVLLKGMLMQESHVRNACL
QAIQPFDLTDLDWAPELWIVCHDDDEQNARLARHVWEDNGLDVPETYLDELIPYLGHDNEYVRLSVAAAIGESVE
QWQSTVEMTVSVLQDYYREKAKLLLPEYDQYGMVMAHTVDRPDPWQARQAVANTFEFLAPSFIDGLLEPFFQFLI
NDQALGDRVADVRKGMLNAGTHTIDLHGPKRLAALISLFESHLAKKTPATEADDQIKEAVVILFGRVARHLDSSD
DRIPSIVDRLVEALSTPAEQVQIAVSDCLSPLVRLMRPKLPSLIDLLFDQLFNAPKYAIRRGAAYGLAGVIRGTG
IAGMKEFDVIRKLQAAAEEKKRYECRQGVMFAFETLSVALGRLFEPYLPLVLPILLSGFGDSTGDVREATQDATR
IIMGGLSGYGLKLILPTLLDGLTDKQWRTKKGCIEVLGMMAYCSPRQLTLSLPIVIPRLTGVLMDSHAQVKTAAN
KSLKQFGEVISNPEIQSLVPVLLKALVDPGKTPNALGSLLKMSFVHYIDHSSLALVIPIIERGLKERGADTKKKA
AQIVGNLASLTASKDFVPYLDNLLPLVHRVLVDPVPEARATAAKTLGTLVERLGEVHFPDLVPGLLRTLKADTSG
VDRQGAAQGLSEVLAGLGMERMEGLLPDVIVNARSPRSSVREGFMSLLVYLPATFGNRFQPHLPKIISPILSGLA
DTEEYVREAAMRAGRMVVTNYSTKAIDLLLPELERNMFDPGWRIRQSSVTLVGELLFKVSGISGKTSDGDEEEEA
EATVAESSRRALVEVLGSKRRDQILAALYLVRQDGVLVVRQSSMHIWKALVHNTPKTVREILPELINQIIYQICE
DQSEQQETAGRTVADISRKFGERVIAEVVLLLSEKASSSDARTREGVCLTLTEVMRSTTDGQREGHEDSIIAIVR
AALVDDEANVRSAAAQAFDVLQEHIGGRAIDQTIPTLLEALRQPGKSSGTALQALREVMAVRAATVFPVLIPTLT
AIPMSVFNARALASLVTVAGNALSRRLTVLLNAVVRVLEEDKDEELLAALDETIQALLASINDAEGLNTLMMTLI
GWAKSDQPPRRASACSLFATFCEVSELDSSLYRVDWVRQLVSLMEDPVVSVHTAAVASLNVFVKSLPKDELESLV
VPLRRSIESTGVPGSAVAGFSLPKGVAPTVPIIIAGLTTGSNEQREQAAYAIGDLVERTEESAIKPYVVSFTGPL
IRVATQATNYPPGVKIAILSALTSMLNRIPTFVKPFFPQLQRTFVKSASDTATNGVRNRAAHALGVLMKHQPRVD
PVVTELIASIKANDDAISSSLMLALAKVVQSASQNLGEKAREACIEIVSDSFKAPHDEHYCHAVGLLVVALSDQP
ELVRNIVTTYLSSGTQPSVLTSHVMRAVLRPDEDFEIPDGSLNLFQKLGMLRSVAQKALESAASDKPIISRPARD
ARDALKEMDDASLRGLF*
Coding >AgabiH97|050440
ATGTCATCAGAACCGGCTCCGAAATTATCCCACGATCGAAATCTCCATCACCGTGTCTGCAAGTCACCAAACTCA
ACTTCCGCGAACGGCGTCCACAAGCGCGAAAATCCACAAAAACACTTGCCTAGAGCAAACCTGCCATCATCCAGG
AAACCTACCTTTGCAAAACTCAAAAAACAAGAGGCCAAAGCGGGTTCTACCGGAGCCTCGTTAACGTCCTTTGAT
ATCACATCGTGGGCTGCGCAGAGTAGTACTGCTGCGATCATGGATGAAAATGAAGGTGTATATGGAGTAGAGAAT
GTATGGGCGAAAGAACGCGTGTTGCAGGACTGGAATGCGTCGGTGGAGCATGCCAGGACGAAATTGTTGGTTGAA
AAAGTCAAGGGCAGAATCGCGTTTCTGCAGGAGGACATTCTGGGAATCGTCAGGTCTGTAGATCTGAGCCTTTCT
CAAATCATGGACGTTTTCCAATTTTTGATGCTCACATATCCGCGATATGGGGACGATAAATCTCAAGCAGCAGTC
GAATCAGTCGGAATGGAGCTAATCTCTCAAGACGAACAACGAGAGATCAAACTCGGCGTGTCCGAGCAAATCATC
GGATGGCTTTCTAATGAAGTGGGTAGATACGCAAAGAGGAACTCCGCAGATTCATATGCGCCAGCGGATTTGTTC
GTTCTTCTCAATTGGGCTTGTGGGATATATACCGTCTGTGTCAAGTGGAACGAAAACTTTCCGACTAGTCCGGCA
TTTAAAGCGCTTGTTGGCTCGTTGGCTCTCTTATTAGATATGGTGCTTGAATCATCCAAGTCAAAAGATACGCTC
AAAAGAGGGAGTCTGGTACGCACGAGGCGTGCTTTGCGATCCTCAGGGTCCACGACTCCGGTAGTGATATCTACA
TTACTCGAGCTCGTGAAAGCCCCTACGTCGCAGAATCCCAGTCGGTTTCTCACACTGATTGGTGTTGCGACCGCG
GTCCTTGTGAGGCAGAAACATGTGCCCACAAGTCCTGAAGAGCGTCTGCCCGAGCAGCTTCAGACCGAAATTTCC
AACATATACACATCAATGATTCTCATGTCACGAGCAGTAACCCCCCCACATATCTTGACATCGTTCGAAGATTTC
ATCGCCACGTATATCACACCCGACTCTCTTGTTTCCAATTACCTTCCCGCTATGGAAAAGGCACTCCTGCGCTCC
CCTGAATATGCCCTTCCAACGCTCACTTCTTTTTTCCAATACTACCGCCATCTTCTCGATGAATCCACATTCCAC
CGCATTCTAACACAGATTATTAGCTGCTCAAAATCAAGTAATGCCGCCGTTCGTATATCCGCTATTGGGCTCTTC
AAAATAATGCAGGGGTCAACTTCTACGCATGGTGTCATTGCGGTTAATAATTTGCTCGCCCTACCCAAAAGTGGA
AAATCGACAGGACCGGAAAATCGGATCGCGTTGTATTCCATGCTCGCATTCTTGCAACCTGGAACGGAAGTCTCA
TCTACTCTCGTCGAGGCTGCAATTCCTTTATTAGCCAAAGAACAAAACGAGGTTGCTACAGCCAAACTTGCTACA
TCTCTTGGACCTCATATCACTTTCCTTCTCAAATTTGATACCGACAAACTCAAGGATGTTACGCCGTTGATCGTT
AAAGACATGAATAGCGCTAAGCCCGCCGTGAGACGAGCTTTTGTCGCGCTTGCTGGAGACATCTTTTATGAAGAG
AATAGTGTTTCATTGGAAGATGAGAAGGCAGTAGTGTTTATGAAAGTTCTATTATCTGCTTTCGAAACGTCACTA
AAGAACGTTTCGGGTAATGTACTGAACAATCCTGCTGGACCGTTGGAGGGCTATATCGCGGTTGCTGTACTGCTT
GGTCCACTACATCATCTCGGTCGATTCGACGATGTTATCTCTAAAAATGCGGTTATTGGAGCTATCGCTACGAGT
ACCGTCAAGCCCTCATTCCTGCTCTGGGAGAAGGTATATCAAAAAGCAACGGAGGAAGTCGACGAGATGTGGTTA
TTGCGCGCTTTGAAAGTATCGTTGAGGTACTTCAAGAAGGAGCTTGTAAAGAATGAAGTCCTGCGGATAAATTTT
GGCTCGGCTTTGTTGCATCTCGCCGTGGAAAGCACACGTAAAGATACGCGTCAAGCCACGAACAAGATGATTTCT
GAAGCAGCAGTTTGGGATCCTCATTTGACGACAACGCTCATTCGTGAATCTGTAGTCGCTTCCTTGTGTCGCGCA
TCATCGACCAAAACGACGACGGGAGAAGATGCGCCAGCTTTGAAAAAACACTCGCGTTTAGCGTCGGTTCTACTG
AGTTCTAATACGTACGACGGCGACGTTGACATGGAACTCAAAGAGGAGCTGGTTACCGAGTTGATTGTTGTCGGG
CACCATGAGTTTGTCTCTGGGCCGTTGAGGCAAACCTGGATTGACATATGTCAAAAGGCAAACATCGATCCAAAA
GCGTTGATTGAGAAGCACGTTGATAAGTTGCTGAAATTGGTCTTGGAATCAACAACGGTGGAGGCAAAGTTCGGT
TTCGCAGAAGCGGCTTACCATGCAGTGACTACCTTGACGTTTATCGCTCCTAGTGCAATACTCCCGCGCATTGTA
GATCAAATTGCGCTCGATCTGGAGTCTTCACTCCTCAACTCATTAACAGACTTTGACTATGGGGTATGGCAAACA
CCTGAGGGCGAAGCATTTGTTGATGTCCTCGCCTCTAACCAAGATACTCCTAAGGTTGTGAAAGGAAAAGGTGCG
CAATTGGCAAAATGGGACGAGGAAGTTCGAAAATCGTTGGCGAATAAAAAAGGCAATGCACCAACGTTGACAAAG
CAACAACAAGCGCTTATTGCGACCCAATTGGAGAAGGAAAGAGGAGTGAGGGAGAGGGTCATAGGAATCAAAGCA
CAAGTTGACCGAGGACTCGCGTTGGTGAAAAGTGTAGTTGACGCTAGCGTTGAGGAGTTTCCTCCCTATATCGCA
CCACTTACGAAGTTAATGCTTGATGGTGTTTTGAAGAATGGAAAAGCGTTGGTAGGCCAGGAGGCGTTCAATATT
TATCTAGAATTAGCGAGGTGTTGTTCCGGGAGATTGGATACGTTCCGAAAATGGCTTGGAATTGCAACCTTGAGG
AGTTTGAAGATAGATTCAATACCGGAGGAGCTGATGGCTGAATCTTTACACAACTTGATCGTCCGTGTACTATAC
CGCCTGAGATCCCTAGCAGAGCAGGCTCCATTCGATGCCTCAACTTTCTCCTACGTTTTCCCTCTTTTAGAGCAG
ATCATACAGCAGGGTGGAATTGCCATGGAGGAAGAGGATGAACCTCTAGAACAGGTTGCGCTGACGTTAGATTTC
ATCAAGTTCCATTGTGGTGAATTCACTGATGCTGCATTTCCTCGCAAACTTACCATGCAGCAACTTGTTCATATC
ATTCGTCATCAACCCAAGTTGAGCAAGAATGCGTCTTCTACGTTGATCGATCTCGGAGAGGCCATTTCGCCAACT
GCAGTACGCGAAGAGATATATGTTTTACTGAAGGGTATGTTGATGCAAGAATCACACGTCAGGAACGCCTGCCTG
CAAGCCATTCAGCCTTTTGATCTCACAGACCTGGATTGGGCTCCCGAGCTATGGATTGTTTGCCATGATGATGAC
GAGCAGAACGCAAGACTTGCGCGCCATGTTTGGGAAGACAACGGTTTGGATGTACCGGAAACGTATTTGGATGAG
TTGATCCCGTACCTTGGTCATGATAATGAATATGTCCGTCTTAGTGTTGCTGCAGCTATCGGGGAGAGTGTGGAA
CAATGGCAGTCAACTGTAGAAATGACTGTTTCGGTTCTACAAGACTACTATCGTGAAAAGGCCAAGCTACTGCTA
CCTGAGTACGATCAATATGGAATGGTGATGGCGCACACTGTAGATCGACCGGATCCCTGGCAAGCAAGGCAGGCA
GTTGCTAACACCTTCGAGTTTCTTGCACCGTCATTTATCGACGGTCTCCTAGAACCATTCTTCCAGTTTCTCATC
AACGATCAGGCTCTTGGTGACAGAGTTGCTGATGTCCGCAAAGGGATGCTCAATGCAGGAACACATACCATTGAT
CTTCATGGGCCTAAGCGCCTTGCCGCCCTCATCTCGTTGTTTGAGTCCCATCTCGCCAAGAAGACCCCTGCAACG
GAGGCAGATGATCAGATCAAAGAGGCTGTTGTGATTTTATTCGGTCGTGTCGCGCGCCATCTGGATTCTTCAGAT
GATAGGATCCCCTCTATTGTTGATCGTTTGGTCGAGGCTCTGTCCACTCCTGCAGAACAGGTGCAGATTGCTGTC
TCTGATTGTCTATCCCCACTTGTGCGCCTCATGCGCCCCAAACTTCCTTCTCTTATCGATCTTCTCTTCGATCAA
CTTTTTAATGCACCGAAATATGCTATTCGTCGAGGAGCTGCATATGGGTTGGCCGGTGTCATTCGCGGAACTGGA
ATTGCGGGCATGAAGGAATTCGATGTCATTCGTAAACTCCAGGCTGCGGCTGAGGAGAAGAAGAGATATGAATGT
CGCCAGGGCGTTATGTTCGCCTTCGAGACACTCTCGGTTGCTCTTGGGCGACTTTTTGAACCTTATCTACCCTTG
GTTCTCCCCATTTTGCTTTCCGGTTTTGGCGATTCCACGGGTGACGTTCGTGAAGCCACACAGGATGCTACTCGG
ATAATCATGGGTGGCCTATCTGGTTACGGGCTGAAGCTTATTTTACCAACCCTGCTGGACGGATTGACCGACAAA
CAGTGGCGAACGAAAAAGGGTTGTATTGAGGTATTAGGCATGATGGCATACTGCTCGCCTAGACAACTTACGCTC
TCACTTCCCATTGTCATCCCTCGCCTTACGGGTGTGCTGATGGACTCGCATGCTCAAGTTAAGACAGCCGCGAAT
AAGAGCTTGAAACAGTTTGGTGAAGTTATCAGTAACCCCGAAATACAGTCTCTTGTTCCTGTTCTCCTTAAAGCG
TTGGTCGATCCTGGTAAGACGCCGAATGCTCTCGGGTCTTTGTTGAAGATGTCTTTCGTACACTATATCGATCAT
TCGTCTTTGGCTTTGGTGATTCCTATCATTGAAAGAGGTCTCAAAGAACGGGGTGCGGACACCAAGAAAAAGGCC
GCACAGATCGTTGGAAACCTAGCCTCGCTTACTGCTTCGAAGGACTTCGTCCCTTACTTAGATAATCTCCTACCT
CTCGTCCATCGAGTTCTTGTCGATCCCGTTCCTGAAGCACGTGCTACTGCGGCGAAGACACTTGGAACACTCGTA
GAACGACTTGGTGAGGTACATTTCCCGGACCTCGTGCCTGGTCTCCTGCGCACCCTCAAGGCAGACACATCCGGA
GTTGACCGACAGGGGGCAGCTCAAGGTCTCAGTGAGGTACTTGCGGGCCTTGGTATGGAGCGTATGGAGGGTTTA
TTGCCTGATGTCATTGTCAACGCTCGATCGCCCAGATCCTCCGTTCGCGAAGGATTCATGTCATTACTGGTTTAC
CTTCCCGCAACCTTTGGCAACCGTTTCCAGCCGCACCTTCCAAAAATCATCTCTCCTATTCTCAGCGGTCTTGCG
GATACAGAAGAATATGTTCGAGAGGCGGCAATGCGCGCCGGTCGAATGGTTGTTACCAATTACTCCACTAAGGCA
ATTGATTTGCTCCTACCTGAACTTGAACGGAACATGTTTGACCCAGGATGGCGTATCAGGCAATCATCAGTCACT
CTGGTAGGAGAACTTTTGTTCAAGGTTTCTGGGATTTCTGGAAAGACCTCGGACGGAGATGAAGAAGAGGAAGCA
GAGGCTACAGTAGCTGAATCTTCACGTCGTGCTTTAGTTGAAGTTCTGGGCTCTAAGCGCCGCGATCAAATTCTA
GCCGCTCTCTATCTTGTTCGTCAGGATGGTGTTCTAGTGGTTCGTCAATCATCTATGCATATCTGGAAGGCTCTC
GTGCACAATACACCGAAAACAGTGCGCGAGATCCTCCCCGAACTCATCAACCAAATAATATACCAGATATGTGAA
GACCAATCAGAACAACAAGAGACCGCTGGGAGAACAGTTGCAGATATATCTCGCAAGTTTGGAGAAAGAGTTATA
GCCGAAGTTGTGTTGCTTCTCAGTGAAAAGGCGTCATCATCTGATGCCCGGACGAGAGAAGGTGTCTGCCTCACA
CTGACGGAAGTCATGAGGAGTACAACGGATGGTCAAAGAGAAGGACATGAGGACAGTATCATCGCCATAGTTCGT
GCCGCGTTGGTAGATGATGAAGCCAATGTTCGTTCTGCCGCAGCACAAGCTTTTGATGTATTGCAAGAACATATC
GGCGGCAGAGCTATCGATCAAACCATTCCGACCCTACTTGAAGCTCTTCGTCAGCCCGGAAAAAGTTCAGGCACT
GCACTGCAGGCACTTCGCGAAGTCATGGCCGTCCGTGCGGCAACGGTATTTCCAGTGCTCATACCAACACTCACG
GCTATTCCAATGTCAGTCTTCAATGCTCGTGCCTTGGCGTCACTCGTTACAGTTGCTGGGAACGCTTTGAGTCGT
CGTCTCACTGTACTTCTGAATGCGGTCGTTCGTGTCCTTGAAGAGGACAAAGACGAAGAGCTATTGGCGGCTCTA
GACGAAACTATCCAAGCGCTCCTTGCTTCCATCAATGATGCTGAAGGATTGAATACGCTCATGATGACACTCATT
GGCTGGGCTAAGAGCGACCAACCGCCAAGAAGAGCTAGCGCATGTAGCTTATTTGCTACATTCTGTGAAGTTTCG
GAACTCGATTCTTCATTGTACCGTGTTGACTGGGTGCGGCAGCTGGTTTCTCTGATGGAGGACCCTGTAGTCTCG
GTGCATACGGCGGCTGTAGCCTCTTTGAATGTCTTCGTGAAATCTCTCCCTAAGGATGAATTGGAATCCTTGGTT
GTCCCCTTGCGTAGAAGCATCGAATCTACGGGAGTACCAGGAAGCGCTGTTGCTGGGTTCAGCCTCCCAAAGGGT
GTGGCTCCAACAGTTCCTATCATCATTGCAGGCCTTACAACCGGTAGTAACGAACAACGGGAACAAGCTGCTTAT
GCGATTGGTGATTTGGTGGAAAGAACGGAAGAGAGCGCCATCAAGCCATACGTTGTATCATTTACTGGGCCTCTT
ATCAGGGTTGCGACGCAAGCGACAAACTATCCGCCAGGCGTCAAGATCGCTATCCTCTCCGCTCTTACGTCTATG
TTGAATCGTATACCCACATTTGTCAAGCCTTTCTTCCCCCAGCTACAGCGTACCTTTGTAAAAAGTGCGAGTGAT
ACAGCCACCAACGGTGTCCGCAACCGTGCCGCTCATGCACTTGGAGTTCTTATGAAACATCAGCCTCGCGTGGAC
CCCGTGGTGACAGAGCTGATTGCTAGTATAAAAGCCAACGACGATGCTATTTCAAGTAGCCTTATGCTCGCATTG
GCAAAAGTGGTTCAGAGCGCATCACAAAACTTAGGAGAAAAGGCTCGCGAGGCCTGTATCGAAATCGTCTCCGAT
AGCTTCAAAGCACCACACGACGAGCACTACTGTCACGCAGTCGGTCTCCTGGTTGTAGCACTCTCAGATCAACCT
GAACTTGTCCGGAACATTGTCACGACCTACTTGTCAAGTGGAACACAGCCCTCAGTGCTGACATCCCATGTAATG
CGGGCTGTTCTCAGGCCCGACGAAGATTTCGAAATTCCCGATGGCTCATTGAATCTATTCCAGAAGTTAGGGATG
TTACGAAGCGTTGCTCAAAAAGCCCTCGAAAGCGCTGCGAGCGACAAGCCTATAATATCTAGACCTGCGAGGGAT
GCCCGAGATGCCCTAAAAGAGATGGATGATGCAAGCTTACGCGGTTTGTTCTGA
Transcript >AgabiH97|050440
ATGTCATCAGAACCGGCTCCGAAATTATCCCACGATCGAAATCTCCATCACCGTGTCTGCAAGTCACCAAACTCA
ACTTCCGCGAACGGCGTCCACAAGCGCGAAAATCCACAAAAACACTTGCCTAGAGCAAACCTGCCATCATCCAGG
AAACCTACCTTTGCAAAACTCAAAAAACAAGAGGCCAAAGCGGGTTCTACCGGAGCCTCGTTAACGTCCTTTGAT
ATCACATCGTGGGCTGCGCAGAGTAGTACTGCTGCGATCATGGATGAAAATGAAGGTGTATATGGAGTAGAGAAT
GTATGGGCGAAAGAACGCGTGTTGCAGGACTGGAATGCGTCGGTGGAGCATGCCAGGACGAAATTGTTGGTTGAA
AAAGTCAAGGGCAGAATCGCGTTTCTGCAGGAGGACATTCTGGGAATCGTCAGGTCTGTAGATCTGAGCCTTTCT
CAAATCATGGACGTTTTCCAATTTTTGATGCTCACATATCCGCGATATGGGGACGATAAATCTCAAGCAGCAGTC
GAATCAGTCGGAATGGAGCTAATCTCTCAAGACGAACAACGAGAGATCAAACTCGGCGTGTCCGAGCAAATCATC
GGATGGCTTTCTAATGAAGTGGGTAGATACGCAAAGAGGAACTCCGCAGATTCATATGCGCCAGCGGATTTGTTC
GTTCTTCTCAATTGGGCTTGTGGGATATATACCGTCTGTGTCAAGTGGAACGAAAACTTTCCGACTAGTCCGGCA
TTTAAAGCGCTTGTTGGCTCGTTGGCTCTCTTATTAGATATGGTGCTTGAATCATCCAAGTCAAAAGATACGCTC
AAAAGAGGGAGTCTGGTACGCACGAGGCGTGCTTTGCGATCCTCAGGGTCCACGACTCCGGTAGTGATATCTACA
TTACTCGAGCTCGTGAAAGCCCCTACGTCGCAGAATCCCAGTCGGTTTCTCACACTGATTGGTGTTGCGACCGCG
GTCCTTGTGAGGCAGAAACATGTGCCCACAAGTCCTGAAGAGCGTCTGCCCGAGCAGCTTCAGACCGAAATTTCC
AACATATACACATCAATGATTCTCATGTCACGAGCAGTAACCCCCCCACATATCTTGACATCGTTCGAAGATTTC
ATCGCCACGTATATCACACCCGACTCTCTTGTTTCCAATTACCTTCCCGCTATGGAAAAGGCACTCCTGCGCTCC
CCTGAATATGCCCTTCCAACGCTCACTTCTTTTTTCCAATACTACCGCCATCTTCTCGATGAATCCACATTCCAC
CGCATTCTAACACAGATTATTAGCTGCTCAAAATCAAGTAATGCCGCCGTTCGTATATCCGCTATTGGGCTCTTC
AAAATAATGCAGGGGTCAACTTCTACGCATGGTGTCATTGCGGTTAATAATTTGCTCGCCCTACCCAAAAGTGGA
AAATCGACAGGACCGGAAAATCGGATCGCGTTGTATTCCATGCTCGCATTCTTGCAACCTGGAACGGAAGTCTCA
TCTACTCTCGTCGAGGCTGCAATTCCTTTATTAGCCAAAGAACAAAACGAGGTTGCTACAGCCAAACTTGCTACA
TCTCTTGGACCTCATATCACTTTCCTTCTCAAATTTGATACCGACAAACTCAAGGATGTTACGCCGTTGATCGTT
AAAGACATGAATAGCGCTAAGCCCGCCGTGAGACGAGCTTTTGTCGCGCTTGCTGGAGACATCTTTTATGAAGAG
AATAGTGTTTCATTGGAAGATGAGAAGGCAGTAGTGTTTATGAAAGTTCTATTATCTGCTTTCGAAACGTCACTA
AAGAACGTTTCGGGTAATGTACTGAACAATCCTGCTGGACCGTTGGAGGGCTATATCGCGGTTGCTGTACTGCTT
GGTCCACTACATCATCTCGGTCGATTCGACGATGTTATCTCTAAAAATGCGGTTATTGGAGCTATCGCTACGAGT
ACCGTCAAGCCCTCATTCCTGCTCTGGGAGAAGGTATATCAAAAAGCAACGGAGGAAGTCGACGAGATGTGGTTA
TTGCGCGCTTTGAAAGTATCGTTGAGGTACTTCAAGAAGGAGCTTGTAAAGAATGAAGTCCTGCGGATAAATTTT
GGCTCGGCTTTGTTGCATCTCGCCGTGGAAAGCACACGTAAAGATACGCGTCAAGCCACGAACAAGATGATTTCT
GAAGCAGCAGTTTGGGATCCTCATTTGACGACAACGCTCATTCGTGAATCTGTAGTCGCTTCCTTGTGTCGCGCA
TCATCGACCAAAACGACGACGGGAGAAGATGCGCCAGCTTTGAAAAAACACTCGCGTTTAGCGTCGGTTCTACTG
AGTTCTAATACGTACGACGGCGACGTTGACATGGAACTCAAAGAGGAGCTGGTTACCGAGTTGATTGTTGTCGGG
CACCATGAGTTTGTCTCTGGGCCGTTGAGGCAAACCTGGATTGACATATGTCAAAAGGCAAACATCGATCCAAAA
GCGTTGATTGAGAAGCACGTTGATAAGTTGCTGAAATTGGTCTTGGAATCAACAACGGTGGAGGCAAAGTTCGGT
TTCGCAGAAGCGGCTTACCATGCAGTGACTACCTTGACGTTTATCGCTCCTAGTGCAATACTCCCGCGCATTGTA
GATCAAATTGCGCTCGATCTGGAGTCTTCACTCCTCAACTCATTAACAGACTTTGACTATGGGGTATGGCAAACA
CCTGAGGGCGAAGCATTTGTTGATGTCCTCGCCTCTAACCAAGATACTCCTAAGGTTGTGAAAGGAAAAGGTGCG
CAATTGGCAAAATGGGACGAGGAAGTTCGAAAATCGTTGGCGAATAAAAAAGGCAATGCACCAACGTTGACAAAG
CAACAACAAGCGCTTATTGCGACCCAATTGGAGAAGGAAAGAGGAGTGAGGGAGAGGGTCATAGGAATCAAAGCA
CAAGTTGACCGAGGACTCGCGTTGGTGAAAAGTGTAGTTGACGCTAGCGTTGAGGAGTTTCCTCCCTATATCGCA
CCACTTACGAAGTTAATGCTTGATGGTGTTTTGAAGAATGGAAAAGCGTTGGTAGGCCAGGAGGCGTTCAATATT
TATCTAGAATTAGCGAGGTGTTGTTCCGGGAGATTGGATACGTTCCGAAAATGGCTTGGAATTGCAACCTTGAGG
AGTTTGAAGATAGATTCAATACCGGAGGAGCTGATGGCTGAATCTTTACACAACTTGATCGTCCGTGTACTATAC
CGCCTGAGATCCCTAGCAGAGCAGGCTCCATTCGATGCCTCAACTTTCTCCTACGTTTTCCCTCTTTTAGAGCAG
ATCATACAGCAGGGTGGAATTGCCATGGAGGAAGAGGATGAACCTCTAGAACAGGTTGCGCTGACGTTAGATTTC
ATCAAGTTCCATTGTGGTGAATTCACTGATGCTGCATTTCCTCGCAAACTTACCATGCAGCAACTTGTTCATATC
ATTCGTCATCAACCCAAGTTGAGCAAGAATGCGTCTTCTACGTTGATCGATCTCGGAGAGGCCATTTCGCCAACT
GCAGTACGCGAAGAGATATATGTTTTACTGAAGGGTATGTTGATGCAAGAATCACACGTCAGGAACGCCTGCCTG
CAAGCCATTCAGCCTTTTGATCTCACAGACCTGGATTGGGCTCCCGAGCTATGGATTGTTTGCCATGATGATGAC
GAGCAGAACGCAAGACTTGCGCGCCATGTTTGGGAAGACAACGGTTTGGATGTACCGGAAACGTATTTGGATGAG
TTGATCCCGTACCTTGGTCATGATAATGAATATGTCCGTCTTAGTGTTGCTGCAGCTATCGGGGAGAGTGTGGAA
CAATGGCAGTCAACTGTAGAAATGACTGTTTCGGTTCTACAAGACTACTATCGTGAAAAGGCCAAGCTACTGCTA
CCTGAGTACGATCAATATGGAATGGTGATGGCGCACACTGTAGATCGACCGGATCCCTGGCAAGCAAGGCAGGCA
GTTGCTAACACCTTCGAGTTTCTTGCACCGTCATTTATCGACGGTCTCCTAGAACCATTCTTCCAGTTTCTCATC
AACGATCAGGCTCTTGGTGACAGAGTTGCTGATGTCCGCAAAGGGATGCTCAATGCAGGAACACATACCATTGAT
CTTCATGGGCCTAAGCGCCTTGCCGCCCTCATCTCGTTGTTTGAGTCCCATCTCGCCAAGAAGACCCCTGCAACG
GAGGCAGATGATCAGATCAAAGAGGCTGTTGTGATTTTATTCGGTCGTGTCGCGCGCCATCTGGATTCTTCAGAT
GATAGGATCCCCTCTATTGTTGATCGTTTGGTCGAGGCTCTGTCCACTCCTGCAGAACAGGTGCAGATTGCTGTC
TCTGATTGTCTATCCCCACTTGTGCGCCTCATGCGCCCCAAACTTCCTTCTCTTATCGATCTTCTCTTCGATCAA
CTTTTTAATGCACCGAAATATGCTATTCGTCGAGGAGCTGCATATGGGTTGGCCGGTGTCATTCGCGGAACTGGA
ATTGCGGGCATGAAGGAATTCGATGTCATTCGTAAACTCCAGGCTGCGGCTGAGGAGAAGAAGAGATATGAATGT
CGCCAGGGCGTTATGTTCGCCTTCGAGACACTCTCGGTTGCTCTTGGGCGACTTTTTGAACCTTATCTACCCTTG
GTTCTCCCCATTTTGCTTTCCGGTTTTGGCGATTCCACGGGTGACGTTCGTGAAGCCACACAGGATGCTACTCGG
ATAATCATGGGTGGCCTATCTGGTTACGGGCTGAAGCTTATTTTACCAACCCTGCTGGACGGATTGACCGACAAA
CAGTGGCGAACGAAAAAGGGTTGTATTGAGGTATTAGGCATGATGGCATACTGCTCGCCTAGACAACTTACGCTC
TCACTTCCCATTGTCATCCCTCGCCTTACGGGTGTGCTGATGGACTCGCATGCTCAAGTTAAGACAGCCGCGAAT
AAGAGCTTGAAACAGTTTGGTGAAGTTATCAGTAACCCCGAAATACAGTCTCTTGTTCCTGTTCTCCTTAAAGCG
TTGGTCGATCCTGGTAAGACGCCGAATGCTCTCGGGTCTTTGTTGAAGATGTCTTTCGTACACTATATCGATCAT
TCGTCTTTGGCTTTGGTGATTCCTATCATTGAAAGAGGTCTCAAAGAACGGGGTGCGGACACCAAGAAAAAGGCC
GCACAGATCGTTGGAAACCTAGCCTCGCTTACTGCTTCGAAGGACTTCGTCCCTTACTTAGATAATCTCCTACCT
CTCGTCCATCGAGTTCTTGTCGATCCCGTTCCTGAAGCACGTGCTACTGCGGCGAAGACACTTGGAACACTCGTA
GAACGACTTGGTGAGGTACATTTCCCGGACCTCGTGCCTGGTCTCCTGCGCACCCTCAAGGCAGACACATCCGGA
GTTGACCGACAGGGGGCAGCTCAAGGTCTCAGTGAGGTACTTGCGGGCCTTGGTATGGAGCGTATGGAGGGTTTA
TTGCCTGATGTCATTGTCAACGCTCGATCGCCCAGATCCTCCGTTCGCGAAGGATTCATGTCATTACTGGTTTAC
CTTCCCGCAACCTTTGGCAACCGTTTCCAGCCGCACCTTCCAAAAATCATCTCTCCTATTCTCAGCGGTCTTGCG
GATACAGAAGAATATGTTCGAGAGGCGGCAATGCGCGCCGGTCGAATGGTTGTTACCAATTACTCCACTAAGGCA
ATTGATTTGCTCCTACCTGAACTTGAACGGAACATGTTTGACCCAGGATGGCGTATCAGGCAATCATCAGTCACT
CTGGTAGGAGAACTTTTGTTCAAGGTTTCTGGGATTTCTGGAAAGACCTCGGACGGAGATGAAGAAGAGGAAGCA
GAGGCTACAGTAGCTGAATCTTCACGTCGTGCTTTAGTTGAAGTTCTGGGCTCTAAGCGCCGCGATCAAATTCTA
GCCGCTCTCTATCTTGTTCGTCAGGATGGTGTTCTAGTGGTTCGTCAATCATCTATGCATATCTGGAAGGCTCTC
GTGCACAATACACCGAAAACAGTGCGCGAGATCCTCCCCGAACTCATCAACCAAATAATATACCAGATATGTGAA
GACCAATCAGAACAACAAGAGACCGCTGGGAGAACAGTTGCAGATATATCTCGCAAGTTTGGAGAAAGAGTTATA
GCCGAAGTTGTGTTGCTTCTCAGTGAAAAGGCGTCATCATCTGATGCCCGGACGAGAGAAGGTGTCTGCCTCACA
CTGACGGAAGTCATGAGGAGTACAACGGATGGTCAAAGAGAAGGACATGAGGACAGTATCATCGCCATAGTTCGT
GCCGCGTTGGTAGATGATGAAGCCAATGTTCGTTCTGCCGCAGCACAAGCTTTTGATGTATTGCAAGAACATATC
GGCGGCAGAGCTATCGATCAAACCATTCCGACCCTACTTGAAGCTCTTCGTCAGCCCGGAAAAAGTTCAGGCACT
GCACTGCAGGCACTTCGCGAAGTCATGGCCGTCCGTGCGGCAACGGTATTTCCAGTGCTCATACCAACACTCACG
GCTATTCCAATGTCAGTCTTCAATGCTCGTGCCTTGGCGTCACTCGTTACAGTTGCTGGGAACGCTTTGAGTCGT
CGTCTCACTGTACTTCTGAATGCGGTCGTTCGTGTCCTTGAAGAGGACAAAGACGAAGAGCTATTGGCGGCTCTA
GACGAAACTATCCAAGCGCTCCTTGCTTCCATCAATGATGCTGAAGGATTGAATACGCTCATGATGACACTCATT
GGCTGGGCTAAGAGCGACCAACCGCCAAGAAGAGCTAGCGCATGTAGCTTATTTGCTACATTCTGTGAAGTTTCG
GAACTCGATTCTTCATTGTACCGTGTTGACTGGGTGCGGCAGCTGGTTTCTCTGATGGAGGACCCTGTAGTCTCG
GTGCATACGGCGGCTGTAGCCTCTTTGAATGTCTTCGTGAAATCTCTCCCTAAGGATGAATTGGAATCCTTGGTT
GTCCCCTTGCGTAGAAGCATCGAATCTACGGGAGTACCAGGAAGCGCTGTTGCTGGGTTCAGCCTCCCAAAGGGT
GTGGCTCCAACAGTTCCTATCATCATTGCAGGCCTTACAACCGGTAGTAACGAACAACGGGAACAAGCTGCTTAT
GCGATTGGTGATTTGGTGGAAAGAACGGAAGAGAGCGCCATCAAGCCATACGTTGTATCATTTACTGGGCCTCTT
ATCAGGGTTGCGACGCAAGCGACAAACTATCCGCCAGGCGTCAAGATCGCTATCCTCTCCGCTCTTACGTCTATG
TTGAATCGTATACCCACATTTGTCAAGCCTTTCTTCCCCCAGCTACAGCGTACCTTTGTAAAAAGTGCGAGTGAT
ACAGCCACCAACGGTGTCCGCAACCGTGCCGCTCATGCACTTGGAGTTCTTATGAAACATCAGCCTCGCGTGGAC
CCCGTGGTGACAGAGCTGATTGCTAGTATAAAAGCCAACGACGATGCTATTTCAAGTAGCCTTATGCTCGCATTG
GCAAAAGTGGTTCAGAGCGCATCACAAAACTTAGGAGAAAAGGCTCGCGAGGCCTGTATCGAAATCGTCTCCGAT
AGCTTCAAAGCACCACACGACGAGCACTACTGTCACGCAGTCGGTCTCCTGGTTGTAGCACTCTCAGATCAACCT
GAACTTGTCCGGAACATTGTCACGACCTACTTGTCAAGTGGAACACAGCCCTCAGTGCTGACATCCCATGTAATG
CGGGCTGTTCTCAGGCCCGACGAAGATTTCGAAATTCCCGATGGCTCATTGAATCTATTCCAGAAGTTAGGGATG
TTACGAAGCGTTGCTCAAAAAGCCCTCGAAAGCGCTGCGAGCGACAAGCCTATAATATCTAGACCTGCGAGGGAT
GCCCGAGATGCCCTAAAAGAGATGGATGATGCAAGCTTACGCGGTTTGTTCTGA
Gene >AgabiH97|050440
ATGTCATCAGAACCGGCTCCGAAATTATCCCACGATCGAAATCTCCATCACCGTGTCTGCAAGTCACCAAACTCA
ACTTCCGCGAACGGCGTCCACAAGCGCGAAAATCCACAAAAACACTTGCCTAGAGCAAACCTGCCATCATCCAGG
AAACCTACCTTTGCAAAACTCAAAAAACAAGAGGCCAAAGCGGGTTCTACCGGAGCCTCGTTAACGTCCTTTGAT
ATCACATCGTGGGCTGCGCAGAGTAGTACTGCTGCGATCATGGATGAAAATGAAGGTGTATATGGAGTAGAGAAT
GTATGGGCGAAAGAACGCGTGTTGCAGGACTGGAATGCGTCGGTGGAGCATGCCAGGACGAAATTGTTGGTTGAA
AAAGTCAAGGGCAGAATCGCGTTTCTGCAGGAGGACATTCTGGGAATCGTCAGGTCTGTAGGTGCGCATCCTTGT
CTCCTTGTCTTTGAGGACTATTTTGTATATCAATAGCCCAGATCTGAGCCTTTCTCAAATCATGGACGTTTTCCA
ATTTTTGATGCTCACATATCCGCGATATGGGGACGATAAATCTCAAGCAGCAGTCGAATCAGTCGGAATGGAGCT
AATCTCTCAAGACGAACAACGAGAGATCAAACTCGGCGTGTCCGAGCAAATCATCGGATGGCTTTCTAATGAAGT
GGGTAGATACGCAAAGAGGAACTCCGCAGAGTGAGTTTTTATTCTATGAATGTCATCTTGGCATTGATCTGAACA
GGAATTAGTTCATATGCGCCAGCGGATTTGTTCGTTCTTCTCAATTGGGCTTGTGGGATATATACCGTCTGTGTC
AAGTGGAACGAAAACTTTCCGACTAGTCCGGCATTTAAAGCGCTTGTTGGCTCGTTGGCTCTCTTATTAGATATG
GTGCTTGAATCATCCAAGTCAAAAGATACGCTCAAAAGAGGGAGTCTGGTACGCACGAGGCGTGCTTTGCGATCC
GTGAGCATCTCTGCCTTATATCCTTAACGGAAAAGCTGACGAAAGACACAGTCAGGGTCCACGACTCCGGTAGTG
ATATCTACATTACTCGAGCTCGTGAAAGCCCCTACGTCGCAGAATCCCAGTCGGTTTCTCACACTGATTGGTGTT
GCGACCGCGGTCCTTGTGAGGCAGAAACATGTGCCCACAAGTCCTGAAGAGCGTCTGCCCGAGCAGCTTCAGGTA
TGTCCAGCTGATTATCACTGGAAATGTATTGACGCATGTCTGCAGACCGAAATTTCCAACATATACACATCAATG
ATTCTCATGTCACGAGCAGTAACCCCCCCACATATCTTGGTACGTGGCAATTCATGTATATGCAGGTCTATTAAT
TCTAATTTTTGCTACTTGGCCAGACATCGTTCGAAGATTTCATCGCCACGTATATCACACCCGACTCTCTTGTTT
CCAATTACCTTCCCGCTATGGAAAAGGCACTCCTGCGCTCCCCTGAATATGCCCTTCCAACGCTCACTTCTTTTT
TCCAATACTACCGCCATCTTCTCGATGAATCCACATTCCACCGCATTCTAACACAGATTATTAGCTGCTCAAAAT
CAAGTAATGCCGCCGTTCGTATATCCGCTATTGGGCTCTTCAAAATAATGCAGGGGTCAACTTCTACGCATGGTG
TCATTGCGGTTAATAATTTGCTCGCCCTACCCAAAAGTGGAAAATCGACAGGACCGGAAAATCGGATCGCGTTGT
ATTCCATGCTCGCATTCTTGCAACCTGGAACGGAAGTCTCATCTACTCTCGTCGAGGCTGCAATTCCTTTATTAG
CCAAAGAACAAAACGAGGTTGCTACAGCCAAACTTGCTACATCTCTTGGACCTCATATCACTTTCCTTCTCAAAT
TTGATACCGACAAACTCAAGGATGTTACGCCGTTGATCGTTAAAGACATGAATAGCGCTAAGCCCGCCGTGAGAC
GAGCTTTTGTCGCGCTTGCTGGAGACATCTTTTATGAAGAGAATAGTGTTTCATTGGAAGATGAGAAGGCAGTAG
TGTTTATGAAAGTTCTATTATCTGCTTTCGAAACGTCACTAAAGAACGTTTCGGGTAATGTACTGAACAATCCTG
CTGGACCGTTGGAGGGCTATATCGCGGTTGCTGTACTGCTTGGTCCACTACATCATCTCGGTCGATTCGGTAAGT
CGCATCCTTGTTGTGTAGCATTATTTTCCTTATCAGCCCAACAGACGATGTTATCTCTAAAAATGCGGTTATTGG
AGCTATCGCTACGAGTACCGTCAAGCCCTCATTCCTGCTCTGGGAGAAGGTATATCAAAAAGCAACGGAGGAAGT
CGACGAGATGTGGTTATTGCGCGCTTTGAAAGTATCGTTGAGGTACTTCAAGAAGGAGCTTGTAAAGAATGAAGT
CCTGCGGTGGGTTTCGTGAAAATGTTGAGTAATGCAACGATACTAACGAGTGTACATAGGATAAATTTTGGCTCG
GCTTTGTTGCATCTCGCCGTGGAAAGCACACGTAAAGATACGCGTCAAGCCACGAACAAGATGATTTCTGAAGCA
GCAGTTTGGGATCCTCATTTGACGACAACGCTCATTCGTGAATCTGTAGTCGCTTCCTTGTGTCGCGCATCATCG
ACCAAAACGACGACGGGAGAAGATGCGCCAGCTTTGAAAAAACACTCGCGTTTAGCGTCGGTTCTACTGAGTTCT
AATACGTACGACGGCGACGTTGACATGGAACTCAAAGAGGAGCTGGTTACCGAGTTGATTGTTGTCGGGCACCAT
GAGTTTGTCTGTTAGTGGTAACTCGATTCCGCCTACGCTTTGGGCTGATGATCTTCGGGTAGCTGGGCCGTTGAG
GCAAACCTGGATTGACATATGTCAAAAGGCAAACATCGATCCAAAAGCGTTGATTGAGAAGCACGTTGATAAGTT
GCTGAAATTGGTCTTGGAATCAACAACGGTGGAGGCAAAGGTGAGTTGAGTTACCCGTTCAATGTTTTCTTCTCG
CTTAAGTAAGCCTGCCGTTTAGTTCGGTTTCGCAGAAGCGGCTTACCATGCAGTGACTACCTTGACGTTTATCGC
TCCTAGTGCAATACTCCCGCGCATTGTAGATCAAATTGCGCTCGATCTGGAGTCTTCACTCCTCAACTCATTAAC
AGACTTTGACTATGGGGTATGGCAAACACCTGAGGGCGAAGCATTTGTTGATGGTAGGACTCACCTTCATACCTT
CCTAATCTCCACTGATCTTCGCGTTAGTCCTCGCCTCTAACCAAGATACTCCTAAGGTTGTGAAAGGAAAAGGTG
CGCAATTGGCAAAATGGGACGAGGAAGTTCGAAAATCGTTGGCGAATAAAAAAGGCAATGCACCAACGTTGACAA
AGCAACAACAAGCGCTTATTGCGACCCAATTGGAGAAGGAAAGAGGAGTGAGGGAGAGGGTCATAGGAATCAAAG
CACAAGTTGACCGAGGACTCGCGTTGGTGAAAAGTGTAGTTGACGCTAGCGTTGAGGAGTTTCCTCCCTATATCG
CACCACTTACGAAGTTAATGCTTGATGGTGTTTTGAAGAATGGAAAAGCGTTGGTAGGCCAGGAGGCGTTCAATA
TTTATCTAGTAAGTTTCGTATATTGCTCGTGGTCATGTGTTGCTGATAAGGGCGTTGACCATGTAGGAATTAGCG
AGGTGTTGTTCCGGGAGATTGGATACGTTCCGAAAATGGCTTGGAATTGCAACCTTGAGGAGTTTGAAGATAGAT
TCAATACCGGAGGAGCTGATGGCTGAATCTTTACACAGTAATCTGTGCTTTTCTATGCCTTCACCTCCACGCTAA
CTGAATGTTTAGACTTGATCGTCCGTGTACTATACCGCCTGAGATCCCTAGCAGAGCAGGCTCCATTCGATGCCT
CAACTTTCTCCTACGTTTTCCCTCTTTTAGAGCAGATCATACAGCAGGGTGGAATTGCCATGGAGGAAGAGGATG
AACCTCTAGAACAGGTTGCGCTGACGTTAGATTTCATCAAGTTCCATTGTGGTGAATGTGAGTAATTTTTCGAAG
TTTGCCCAAAGCTGCCTCACTGACCAAGATTACAGTCACTGATGCTGCATTTCCTCGCAAACTTACCATGCAGCA
ACTTGTTCATATCATTCGTCATCAACCCAAGTTGAGCAAGAATGCGTCTTCTACGTTGATCGATCTCGGAGAGGC
CATTTCGCCAACTGCAGTACGCGAAGAGATATATGTTTTACTGAAGGGTATGTTGATGCAAGAATCACACGTCAG
GAACGCCTGCCTGCAAGCCATTCAGGTGAGAAGGATAGTTCCAATGATTAAACCCTAACCCTAAACTAAGGTATA
ATTCAGCCTTTTGATCTCACAGACCTGGATTGGGCTCCCGAGCTATGGATTGTTTGCCATGATGATGACGAGCAG
AACGCAAGACTTGCGCGCCATGTTTGGGAAGACAACGGTTTGGATGTACCGGAAACGTATTTGGATGAGTTGATC
CCGTACCTTGGTGTGTTCATCCTCAAGCAACTTGTTCTAATCTTGAATATTCACGTGCTGTCAAAGGTCATGATA
ATGAATATGTCCGTCTTAGTGTTGCTGCAGCTATCGGGGAGAGTGTGGAACAATGGCAGTCAACTGTAGAAATGA
CTGTTTCGGTTCTACAAGACTACTATCGTGAAAAGGTTCGCTTTCAATTCTGTGTTTCTGCTCGCGCTCTTAGTT
TCTTTTTCTAGGCCAAGCTACTGCTACCTGAGTACGATCAATATGTATGTATTGCTCTAAAAAGTTTATGTACTA
CGAACTCATAAGAACTCAGGGAATGGTGATGGCGCACACTGTAGATCGACCGGATCCCTGGCAAGCAAGGCAGGC
AGTTGCTAACACCTTCGAGTTTCTTGCACCGTCATTTATCGACGGTCTCCTAGAACCATTCTTCCAGTTTCTCAT
CAACGATCAGGCTCTTGGTGACAGAGTTGCTGATGTCCGCAAAGGGATGCTCAATGCAGGAACACATACCATTGA
TCTTCATGGGCCTAAGCGCCTTGCCGCCCTCATCTCGTTGTTTGAGTCCCATCTCGCCAAGAAGACCCCTGCAAC
GGAGGCAGATGATCAGATCAAAGAGGCTGTTGTGATTTTATTCGGTCGTGTCGCGCGCCATCTGGATTCTTCAGA
TGATAGGATCCCCTCTATTGTTGATCGTTTGGTCGAGGCTCTGTCCACTCCTGCAGAACAGGTGCAGATTGCTGT
CTCTGATTGTCTATCCCCACTTGTGCGCCTCATGCGCCCCAAACTTCCTTCTCTTATCGATCTTCTCTTCGATCA
ACTTTTTAATGCACCGAAATATGCTATTCGTCGAGGAGCTGCATATGGGTTGGCCGGTGTCATTCGCGGAACTGG
AATTGCGGGCATGAAGGAATTCGATGTCATTCGTAAACTCCAGGCTGCGGCTGAGGAGAAGAAGAGATATGAATG
TCGCCAGGGCGTTATGTTCGCCTTCGAGACACTCTCGGTTGCTCTTGGGCGACTTTTTGAACCTTATCTACCCTT
GGTTCTCCCCATTTTGCTTTCCGGTTTTGGCGATTCCACGGGTGACGTTCGTGAAGCCACACAGGATGCTACTCG
GATAATCATGGGTGGCCTATCTGGTTACGGGCTGAAGCTTATTTTACCAACCCTGCTGGACGGATTGACCGACAA
ACAGTGGCGAACGAAAAAGGGTTGTATTGAGGTATTAGGCATGATGGCATACTGCTCGCCTAGACAACTTACGCT
CTCACTTCCCATTGTCATCCCTCGCCTTACGGGTGTGCTGATGGACTCGCATGCTCAAGTTAAGACAGCCGCGAA
TAAGAGCTTGAAACAGTTTGGTGAAGTTATCAGTAACCCCGAAATACAGTCTCTTGTTCCTGTTCTCCTTAAAGC
GTTGGTCGATCCTGGTAAGACGCCGAATGCTCTCGGGTCTTTGTTGAAGATGTCTTTCGTACACTATATCGATCA
TTCGTCTTTGGCTTTGGCAAGTATTGTGAAATTCGCTTCCTTTATCTACGCTCATACCAATACTCTAGGTGATTC
CTATCATTGAAAGAGGTCTCAAAGAACGGGGTGCGGACACCAAGAAAAAGGCCGCACAGATCGTTGGAAACCTAG
CCTCGCTTACTGCTTCGAAGGACTTCGTCCCTTACTTAGATAATCTCCTACCTCTCGTCCATCGAGTTCTTGTCG
ATCCCGTTCCTGAAGCACGTGCTACTGCGGCGAAGACACTTGGAACACTCGTAGAACGACTTGGTGAGGTACATT
TCCCGGACCTCGTGCCTGGTCTCCTGCGCACCCTCAAGGCAGACACATCCGGAGTTGACCGACAGGGGGCAGCTC
AAGGTCTCAGTGAGGTACTTGCGGGCCTTGGTATGGAGCGTATGGAGGGTTTATTGCCTGATGTCATTGTCAACG
CTCGATCGCCCAGATCCTCCGTTCGCGAAGGATTCATGTCATTACTGGTTTACCTTCCCGCAACCTTTGGCAACC
GTTTCCAGCCGCACCTTCCAAAAATCATCTCTCCTATTCTCAGCGGTCTTGCGGATACAGAAGAATATGTTCGAG
AGGCGGCAATGCGCGCCGGTCGAATGGTTGTTACCAATTACTCCACTAAGGCAATTGATTTGCTCCTACCTGAAC
TTGAACGGAACATGTTTGACCCAGGATGGCGTATCAGGGTATGTTCCGCTTGCAGATTAATCGTGATCAATTGCT
TACCTACGCCCAGCAATCATCAGTCACTCTGGTAGGAGAACTTTTGTTCAAGGTTTCTGGGATTTCTGGAAAGAC
CTCGGACGGAGATGAAGAAGAGGAAGCAGAGGCTACAGTAGCTGAATCTTCACGTCGTGCTTTAGTTGAAGTTCT
GGGCTCTAAGCGCCGCGATCAAATTCTAGCCGCTCTCTATCTTGTTCGTCAGGATGGTGTTCTAGTGGTTCGTCA
ATCATCTATGCATATCTGGAAGGCTCTCGTGCACAATACACCGAAAACAGGTAAGCAGTCATAGTATATATTTTC
TGATTGAGGCTTATGTCTTCTAGTGCGCGAGATCCTCCCCGAACTCATCAACCAAATAATATACCAGATATGTGA
AGACCAATCAGAACAACAAGAGGTATAGTTCTTGTATAGTCAAATTCACTGGTGCTGATGAACTGGACTTGATAG
ACCGCTGGGAGAACAGTTGCAGATATATCTCGCAAGTTTGGAGAAAGAGTTATAGCCGAAGTTGTGTTGCTTCTC
AGTGAAAAGGCGTCATCATCTGATGCCCGGACGAGAGAAGGTGTCTGCCTCACACTGACGGAAGTCATGTAGGTC
ATGGTCCACTTCTAAGAAATACAGACAACTAATATGTCGTGATCAACAGGAGGAGTACAACGGATGGTCAAAGAG
AAGGACATGAGGACAGTATCATCGCCATAGTTCGTGCCGCGTTGGTAGATGATGAAGCCAATGTTCGTTCTGCCG
CAGCACAAGCTTTTGATGTATTGCAAGAACATATCGGCGGCAGAGCTATCGATCAAACCATTCCGACCCTACTTG
AAGCTCTTCGTCAGCCCGGAAAAAGTTCAGGCACTGCACTGCAGGCACTTCGCGAAGTCATGGCCGTGAGTTTCC
TACTACTGTTTCTTTTTCCCCCTCTTAATTCCTCTCAGGTCCGTGCGGCAACGGTATTTCCAGTGCTCATACCAA
CACTCACGGCTATTCCAATGTCAGTCTTCAATGCTCGTGCCTTGGCGTCACTCGTTACAGTTGCTGGGAACGCTT
TGAGTCGTCGTCTCACTGTACTTCTGAATGCGGTCGTTCGTGTCCTTGAAGAGGACAAAGACGAAGAGCTATTGG
CGGCTCTAGACGAAACTATCCAAGCGCTCCTTGCTTCCATCAATGATGCTGAAGGATTGAATACGCTCATGATGA
CACTCATTGGCTGGTGCGTTACCCGCCTATCTGTACACAACCCCATTAATGAGAAAAATCGGAAAAATCAGGGCT
AAGAGCGACCAACCGCCAAGAAGAGCTAGCGCATGTAGCTTATTTGCTACATTCTGTGAAGTTTCGGAACTCGAT
TCTTCATTGTACCGTGTTGACTGGGTGCGGCAGCTGGTTTCTCTGATGGAGGACCCTGTAGTCTCGGTGCATACG
GCGGCTGTAGCCTCTTTGAATGTCTTCGTGAAATCTCTCCCTAAGGATGAATTGGAATCCTTGGTTGTCCCCTTG
CGTAGAAGCATCGAATCTACGGGAGTACCAGGAAGCGCTGTTGCTGGGTTCAGCCTCCCAAAGGGTGTGGCTCCA
ACAGTTCCTATCATCATTGCAGGCCTTACAACCGGTAGTAACGAACAACGGGAACAAGCTGCTTATGCGATTGGT
GATTTGGTGGAAAGAACGGAAGAGAGCGCCATCAAGCCATACGTTGTATCATTTACTGGGCCTCTTATCAGGGTT
GCGACGCAAGCGACAAACTATCCGCCAGGCGTCAAGATCGCTATCCTCTCCGCTCTTACGTCTATGTTGAATCGT
ATACCCACATTTGTCAAGCCTTTCTTCCCCCAGCTACAGCGTACCTTTGTAAAAAGTGCGAGTGATACAGCCACC
AACGGTGTCCGCAACCGTGCCGCTCATGCACTTGGAGTTCTTATGAAACATCAGCCTCGCGTGGACCCCGTGGTG
ACAGAGCTGATTGCTAGTATAAAAGCCAACGACGATGCTATTTCAAGTAGCCTTATGCTCGCATTGGCAAAAGTG
GTTCAGAGCGCATCACAAAACTTAGGAGAAAAGGCTCGCGAGGCCTGTATCGAAATCGTCTCCGATAGCTTCAAA
GCACCACACGACGGTGAGTATGCGATGATGATGACTTTCCTGTTTACCGAATACCCAATCATAGAGCACTACTGT
CACGCAGTCGGTCTCCTGGTTGTAGCACTCTCAGATCAACCTGAACTTGTCCGGAACATTGTCACGTATGTGAAA
GCCATTCATCAACCGTGGTAAGATTAACTCGTCTGCTCCACAGGACCTACTTGTCAAGTGGAACACAGCCCTCAG
TGCTGACATCCCATGTAATGCGGGCTGTTCTCAGGCCCGACGAAGATTTCGAAATTCCCGATGGCTCATTGAATC
TATTCCAGAAGTTAGGGATGTTACGAAGCGTTGCTCAAAAAGCCCTCGAAAGCGCTGCGAGCGACAAGCCTATAA
TATCTAGACCTGCGAGGGATGCCCGAGATGCCCTAAAAGAGATGGATGATGCAAGCTTACGCGGTTTGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail