Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|050390
Gene name
Locationscaffold_2:2935278..2936481
Strand-
Gene length (bp)1203
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01648 ACPS 4'-phosphopantetheinyl transferase superfamily 1.2E-12 144 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 17 250 5.0E-50
sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS2 PE=1 SV=2 17 248 1.0E-46
sp|P15368|FAS2_PENPA Fatty acid synthase subunit alpha OS=Penicillium patulum GN=FAS2 PE=3 SV=1 17 252 5.0E-43
sp|Q765N2|FAS2_LACKL Fatty acid synthase subunit alpha OS=Lachancea kluyveri GN=FAS2 PE=3 SV=1 17 248 8.0E-43
sp|P43098|FAS2_CANAX Fatty acid synthase subunit alpha OS=Candida albicans GN=FAS2 PE=3 SV=1 17 241 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 17 250 5.0E-50
sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS2 PE=1 SV=2 17 248 1.0E-46
sp|P15368|FAS2_PENPA Fatty acid synthase subunit alpha OS=Penicillium patulum GN=FAS2 PE=3 SV=1 17 252 5.0E-43
sp|Q765N2|FAS2_LACKL Fatty acid synthase subunit alpha OS=Lachancea kluyveri GN=FAS2 PE=3 SV=1 17 248 8.0E-43
sp|P43098|FAS2_CANAX Fatty acid synthase subunit alpha OS=Candida albicans GN=FAS2 PE=3 SV=1 17 241 5.0E-38
sp|P78615|FAS2_EMEND Fatty acid synthase subunit alpha OS=Emericella nidulans GN=fasA PE=3 SV=1 17 252 2.0E-36
sp|G8BAW7|FAS2_CANPC Fatty acid synthase subunit alpha OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) GN=FAS2 PE=2 SV=1 17 241 3.0E-34
sp|Q5B7V0|FAS2_EMENI Fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fasA PE=2 SV=1 17 250 5.0E-34
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 17 248 1.0E-25
sp|Q2RGI1|ACPS_MOOTA Holo-[acyl-carrier-protein] synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=acpS PE=3 SV=1 138 239 7.0E-13
sp|Q2LTJ7|ACPS_SYNAS Holo-[acyl-carrier-protein] synthase OS=Syntrophus aciditrophicus (strain SB) GN=acpS PE=3 SV=1 149 242 3.0E-10
sp|A5US51|ACPS_ROSS1 Holo-[acyl-carrier-protein] synthase OS=Roseiflexus sp. (strain RS-1) GN=acpS PE=3 SV=1 138 251 1.0E-09
sp|B1I1U5|ACPS_DESAP Holo-[acyl-carrier-protein] synthase OS=Desulforudis audaxviator (strain MP104C) GN=acpS PE=3 SV=1 131 250 3.0E-09
sp|A4XIB7|ACPS_CALS8 Holo-[acyl-carrier-protein] synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=acpS PE=3 SV=1 131 254 3.0E-09
sp|B9MKY6|ACPS_CALBD Holo-[acyl-carrier-protein] synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=acpS PE=3 SV=1 152 251 4.0E-09
sp|B2TQY6|ACPS_CLOBB Holo-[acyl-carrier-protein] synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=acpS PE=3 SV=1 131 248 5.0E-09
sp|A7NPN5|ACPS_ROSCS Holo-[acyl-carrier-protein] synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=acpS PE=3 SV=1 144 250 1.0E-08
sp|B2V003|ACPS_CLOBA Holo-[acyl-carrier-protein] synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=acpS PE=3 SV=1 131 248 2.0E-08
sp|Q254H8|ACPS_CHLFF Holo-[acyl-carrier-protein] synthase OS=Chlamydophila felis (strain Fe/C-56) GN=acpS PE=3 SV=1 144 250 3.0E-08
sp|Q8R857|ACPS_CALS4 Holo-[acyl-carrier-protein] synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=acpS PE=3 SV=1 136 240 3.0E-08
sp|B2A4X6|ACPS_NATTJ Holo-[acyl-carrier-protein] synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=acpS PE=3 SV=1 132 242 4.0E-08
sp|Q9Z8M5|ACPS_CHLPN Holo-[acyl-carrier-protein] synthase OS=Chlamydia pneumoniae GN=acpS PE=3 SV=1 138 239 2.0E-07
sp|Q97LR5|ACPS_CLOAB Holo-[acyl-carrier-protein] synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=acpS PE=3 SV=1 131 248 2.0E-07
sp|B0K5Y6|ACPS_THEPX Holo-[acyl-carrier-protein] synthase OS=Thermoanaerobacter sp. (strain X514) GN=acpS PE=3 SV=1 136 250 3.0E-07
sp|B0KD52|ACPS_THEP3 Holo-[acyl-carrier-protein] synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=acpS PE=3 SV=1 136 250 3.0E-07
sp|B0SM94|ACPS_LEPBP Holo-[acyl-carrier-protein] synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acpS PE=3 SV=1 131 241 7.0E-07
sp|B0SE17|ACPS_LEPBA Holo-[acyl-carrier-protein] synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acpS PE=3 SV=1 131 241 7.0E-07
sp|Q5L623|ACPS_CHLAB Holo-[acyl-carrier-protein] synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=acpS PE=3 SV=1 138 241 1.0E-06
sp|Q7UQA5|ACPS_RHOBA Holo-[acyl-carrier-protein] synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acpS PE=3 SV=1 145 247 1.0E-06
sp|B8G840|ACPS_CHLAD Holo-[acyl-carrier-protein] synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=acpS PE=3 SV=1 144 245 2.0E-06
sp|Q820E7|ACPS_CHLCV Holo-[acyl-carrier-protein] synthase OS=Chlamydophila caviae (strain GPIC) GN=acpS PE=3 SV=1 138 240 2.0E-06
sp|Q5Z0D8|ACPS_NOCFA Holo-[acyl-carrier-protein] synthase OS=Nocardia farcinica (strain IFM 10152) GN=acpS PE=3 SV=1 131 221 3.0E-06
sp|B8I3U1|ACPS_CLOCE Holo-[acyl-carrier-protein] synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=acpS PE=3 SV=1 144 248 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008897 holo-[acyl-carrier-protein] synthase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016740 transferase activity No
GO:0016780 phosphotransferase activity, for other substituted phosphate groups No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 5.52 2.39 8.66
Initials Initials knots 5.15 2.17 8.14
Pileal_Stipeal_center Stage I stipe center 3.63 1.43 5.84
Pileal_Stipeal_shell Stage I stipe shell 5.36 2.31 8.40
DIF_stipe_center Stage II stipe center 3.72 1.49 5.95
DIF_stipe_shell Stage II stipe shell 4.76 1.98 7.53
DIF_stipe_skin Stage II stipe skin 4.63 1.93 7.34
DIF_cap_skin Stage II cap skin 5.20 2.22 8.18
DIF_cap_tissue Stage II cap tissue 4.42 1.77 7.07
DIF_gill_tissue Stage II gill tissue 4.27 1.73 6.81
YFB_stipe_center Young fruiting body stipe center 3.85 1.53 6.17
YFB_stipe_shell Young fruiting body stipe shell 4.48 1.81 7.15
YFB_stipe_skin Young fruiting body stipe skin 4.97 2.10 7.84
YFB_cap_skin Young fruiting body cap skin 5.78 2.51 9.06
YFB_cap_tissue Young fruiting body cap tissue 5.18 2.21 8.15
YFB_gill_tissue Young fruiting body gill tissue 6.28 2.72 9.85
YFB_veil Young fruiting body veil 5.87 2.53 9.22

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.654695 no
Casing YFB_stipe_center 0.474617 no
Casing YFB_stipe_shell 0.730311 no
Casing YFB_stipe_skin 0.880313 no
Casing YFB_cap_skin 0.953044 no
Casing YFB_cap_tissue 0.935866 no
Casing YFB_gill_tissue 0.850733 no
Casing YFB_veil 0.936594 no
Casing Initials 0.927927 no
Casing Pileal_Stipeal_center 0.376795 no
Casing Pileal_Stipeal_shell 0.969869 no
Casing DIF_stipe_center 0.420639 no
Casing DIF_stipe_shell 0.815792 no
Casing DIF_stipe_skin 0.775932 no
Casing DIF_cap_skin 0.939253 no
Casing DIF_cap_tissue 0.709147 no
DIF_gill_tissue YFB_stipe_center 0.891627 no
DIF_gill_tissue YFB_stipe_shell 0.954167 no
DIF_gill_tissue YFB_stipe_skin 0.821425 no
DIF_gill_tissue YFB_cap_skin 0.569998 no
DIF_gill_tissue YFB_cap_tissue 0.762124 no
DIF_gill_tissue YFB_gill_tissue 0.442465 no
DIF_gill_tissue YFB_veil 0.550689 no
YFB_stipe_center YFB_stipe_shell 0.827384 no
YFB_stipe_center YFB_stipe_skin 0.662490 no
YFB_stipe_center YFB_cap_skin 0.400535 no
YFB_stipe_center YFB_cap_tissue 0.591306 no
YFB_stipe_center YFB_gill_tissue 0.283077 no
YFB_stipe_center YFB_veil 0.382056 no
YFB_stipe_shell YFB_stipe_skin 0.887184 no
YFB_stipe_shell YFB_cap_skin 0.653141 no
YFB_stipe_shell YFB_cap_tissue 0.835452 no
YFB_stipe_shell YFB_gill_tissue 0.516964 no
YFB_stipe_shell YFB_veil 0.630938 no
YFB_stipe_skin YFB_cap_skin 0.816227 no
YFB_stipe_skin YFB_cap_tissue 0.959134 no
YFB_stipe_skin YFB_gill_tissue 0.685859 no
YFB_stipe_skin YFB_veil 0.792957 no
YFB_cap_skin YFB_cap_tissue 0.879599 no
YFB_cap_skin YFB_gill_tissue 0.912072 no
YFB_cap_skin YFB_veil 0.984130 no
YFB_cap_tissue YFB_gill_tissue 0.757578 no
YFB_cap_tissue YFB_veil 0.853996 no
YFB_gill_tissue YFB_veil 0.928947 no
Initials DIF_gill_tissue 0.765177 no
Initials YFB_stipe_center 0.582920 no
Initials YFB_stipe_shell 0.835968 no
Initials YFB_stipe_skin 0.961971 no
Initials YFB_cap_skin 0.865842 no
Initials YFB_cap_tissue 0.993868 no
Initials YFB_gill_tissue 0.744770 no
Initials YFB_veil 0.845955 no
Initials Pileal_Stipeal_center 0.477106 no
Initials Pileal_Stipeal_shell 0.960455 no
Initials DIF_stipe_center 0.523920 no
Initials DIF_stipe_shell 0.911254 no
Initials DIF_stipe_skin 0.877773 no
Initials DIF_cap_skin 0.989042 no
Initials DIF_cap_tissue 0.815123 no
Pileal_Stipeal_center DIF_gill_tissue 0.814101 no
Pileal_Stipeal_center YFB_stipe_center 0.941985 no
Pileal_Stipeal_center YFB_stipe_shell 0.739028 no
Pileal_Stipeal_center YFB_stipe_skin 0.556243 no
Pileal_Stipeal_center YFB_cap_skin 0.313705 no
Pileal_Stipeal_center YFB_cap_tissue 0.487001 no
Pileal_Stipeal_center YFB_gill_tissue 0.212031 no
Pileal_Stipeal_center YFB_veil 0.294241 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.432554 no
Pileal_Stipeal_center DIF_stipe_center 0.978142 no
Pileal_Stipeal_center DIF_stipe_shell 0.632144 no
Pileal_Stipeal_center DIF_stipe_skin 0.674054 no
Pileal_Stipeal_center DIF_cap_skin 0.478795 no
Pileal_Stipeal_center DIF_cap_tissue 0.762687 no
Pileal_Stipeal_shell DIF_gill_tissue 0.700286 no
Pileal_Stipeal_shell YFB_stipe_center 0.516659 no
Pileal_Stipeal_shell YFB_stipe_shell 0.779173 no
Pileal_Stipeal_shell YFB_stipe_skin 0.918279 no
Pileal_Stipeal_shell YFB_cap_skin 0.916850 no
Pileal_Stipeal_shell YFB_cap_tissue 0.966151 no
Pileal_Stipeal_shell YFB_gill_tissue 0.805113 no
Pileal_Stipeal_shell YFB_veil 0.899738 no
Pileal_Stipeal_shell DIF_stipe_center 0.460373 no
Pileal_Stipeal_shell DIF_stipe_shell 0.860174 no
Pileal_Stipeal_shell DIF_stipe_skin 0.821895 no
Pileal_Stipeal_shell DIF_cap_skin 0.969909 no
Pileal_Stipeal_shell DIF_cap_tissue 0.757331 no
DIF_stipe_center DIF_gill_tissue 0.845683 no
DIF_stipe_center YFB_stipe_center 0.965367 no
DIF_stipe_center YFB_stipe_shell 0.775193 no
DIF_stipe_center YFB_stipe_skin 0.594174 no
DIF_stipe_center YFB_cap_skin 0.345193 no
DIF_stipe_center YFB_cap_tissue 0.523438 no
DIF_stipe_center YFB_gill_tissue 0.239428 no
DIF_stipe_center YFB_veil 0.326667 no
DIF_stipe_center DIF_stipe_shell 0.669319 no
DIF_stipe_center DIF_stipe_skin 0.713600 no
DIF_stipe_center DIF_cap_skin 0.516659 no
DIF_stipe_center DIF_cap_tissue 0.796435 no
DIF_stipe_shell DIF_gill_tissue 0.879935 no
DIF_stipe_shell YFB_stipe_center 0.726186 no
DIF_stipe_shell YFB_stipe_shell 0.936658 no
DIF_stipe_shell YFB_stipe_skin 0.953496 no
DIF_stipe_shell YFB_cap_skin 0.740416 no
DIF_stipe_shell YFB_cap_tissue 0.907585 no
DIF_stipe_shell YFB_gill_tissue 0.604297 no
DIF_stipe_shell YFB_veil 0.717224 no
DIF_stipe_shell DIF_stipe_skin 0.972299 no
DIF_stipe_shell DIF_cap_skin 0.900184 no
DIF_stipe_shell DIF_cap_tissue 0.921281 no
DIF_stipe_skin DIF_gill_tissue 0.914863 no
DIF_stipe_skin YFB_stipe_center 0.771411 no
DIF_stipe_skin YFB_stipe_shell 0.967830 no
DIF_stipe_skin YFB_stipe_skin 0.925381 no
DIF_stipe_skin YFB_cap_skin 0.701691 no
DIF_stipe_skin YFB_cap_tissue 0.878029 no
DIF_stipe_skin YFB_gill_tissue 0.560937 no
DIF_stipe_skin YFB_veil 0.678432 no
DIF_stipe_skin DIF_cap_skin 0.868901 no
DIF_stipe_skin DIF_cap_tissue 0.953764 no
DIF_cap_skin DIF_gill_tissue 0.753345 no
DIF_cap_skin YFB_stipe_center 0.575942 no
DIF_cap_skin YFB_stipe_shell 0.825803 no
DIF_cap_skin YFB_stipe_skin 0.952922 no
DIF_cap_skin YFB_cap_skin 0.880257 no
DIF_cap_skin YFB_cap_tissue 0.994717 no
DIF_cap_skin YFB_gill_tissue 0.763522 no
DIF_cap_skin YFB_veil 0.861598 no
DIF_cap_skin DIF_cap_tissue 0.805344 no
DIF_cap_tissue DIF_gill_tissue 0.965770 no
DIF_cap_tissue YFB_stipe_center 0.847700 no
DIF_cap_tissue YFB_stipe_shell 0.986635 no
DIF_cap_tissue YFB_stipe_skin 0.868815 no
DIF_cap_tissue YFB_cap_skin 0.632189 no
DIF_cap_tissue YFB_cap_tissue 0.818059 no
DIF_cap_tissue YFB_gill_tissue 0.501407 no
DIF_cap_tissue YFB_veil 0.611955 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|050390
MIAMLASTFLRSTLNVIQAGVMSSFGFGQVGGTALVVHPRYLFGALELNFYEQYKERNRTRALQSYKAMSDMMVK
NSLVKIKEYPPFTPENEQEVLMNSMARVTCDPKTGEYYFKGKLPREAPLNLSSQTSISLALVLTELITSVSSHNP
TFVAPNFTEAETAYCRAQPSPASSFAALWVGKEAVFKSLDVESAGAAAVLKDIEILNDDTGVPSVHLHSEAQVKA
QERGVANVVIPLSHSETITIGFAQASYEKVKVSTFIFLWCANLASIQEDQRRILHPLSAGHFSASFCVGYAQGNV
TCHHMSRSAHPNFLRTPHPHCLNLFHCLSARASVAHSCSSTCVAVYGVTPA*
Coding >AgabiH97|050390
ATGATTGCTATGCTCGCTTCCACATTCTTGCGTTCCACCTTGAACGTTATCCAAGCTGGTGTTATGTCTTCCTTT
GGTTTCGGTCAAGTTGGTGGAACAGCCCTTGTTGTACATCCTCGCTACCTCTTTGGTGCTCTCGAACTGAATTTC
TATGAGCAATACAAGGAAAGAAACCGCACTCGTGCACTCCAGTCCTACAAGGCCATGAGTGACATGATGGTCAAA
AACTCGCTCGTGAAGATCAAGGAATACCCACCATTCACACCCGAAAACGAACAAGAAGTACTCATGAACTCGATG
GCGCGTGTCACTTGTGATCCCAAGACTGGCGAATATTATTTCAAGGGCAAGCTTCCTAGAGAGGCGCCCCTCAAT
CTATCATCTCAAACTTCAATATCATTGGCGTTGGTGTTGACCGAGCTTATCACATCTGTTTCCTCGCACAATCCC
ACATTTGTTGCTCCCAACTTCACTGAGGCGGAAACAGCTTACTGTCGCGCTCAACCTTCGCCTGCATCCTCATTC
GCAGCTCTCTGGGTTGGAAAGGAAGCTGTCTTCAAATCCCTTGACGTCGAGTCGGCAGGAGCTGCAGCTGTTCTG
AAAGATATTGAGATTCTCAACGATGATACCGGTGTTCCCTCTGTTCATCTCCACAGTGAGGCCCAAGTCAAAGCG
CAGGAGCGGGGAGTTGCCAACGTAGTAATTCCTTTGAGTCATTCTGAGACTATCACCATTGGCTTTGCGCAAGCC
TCATATGAGAAAGTCAAAGTCAGCACCTTTATCTTTCTTTGGTGCGCCAACCTTGCCTCAATTCAGGAAGACCAA
AGGAGGATCTTACATCCTCTCAGCGCTGGACATTTCTCTGCCTCATTCTGTGTAGGCTACGCTCAGGGGAATGTC
ACGTGCCATCATATGTCACGTTCTGCCCATCCCAACTTCCTCCGTACTCCGCATCCGCACTGTTTGAATCTCTTT
CATTGTCTCAGTGCCCGTGCCTCGGTCGCCCACTCCTGTTCCTCTACCTGTGTGGCTGTCTATGGCGTCACCCCT
GCCTAA
Transcript >AgabiH97|050390
ATGATTGCTATGCTCGCTTCCACATTCTTGCGTTCCACCTTGAACGTTATCCAAGCTGGTGTTATGTCTTCCTTT
GGTTTCGGTCAAGTTGGTGGAACAGCCCTTGTTGTACATCCTCGCTACCTCTTTGGTGCTCTCGAACTGAATTTC
TATGAGCAATACAAGGAAAGAAACCGCACTCGTGCACTCCAGTCCTACAAGGCCATGAGTGACATGATGGTCAAA
AACTCGCTCGTGAAGATCAAGGAATACCCACCATTCACACCCGAAAACGAACAAGAAGTACTCATGAACTCGATG
GCGCGTGTCACTTGTGATCCCAAGACTGGCGAATATTATTTCAAGGGCAAGCTTCCTAGAGAGGCGCCCCTCAAT
CTATCATCTCAAACTTCAATATCATTGGCGTTGGTGTTGACCGAGCTTATCACATCTGTTTCCTCGCACAATCCC
ACATTTGTTGCTCCCAACTTCACTGAGGCGGAAACAGCTTACTGTCGCGCTCAACCTTCGCCTGCATCCTCATTC
GCAGCTCTCTGGGTTGGAAAGGAAGCTGTCTTCAAATCCCTTGACGTCGAGTCGGCAGGAGCTGCAGCTGTTCTG
AAAGATATTGAGATTCTCAACGATGATACCGGTGTTCCCTCTGTTCATCTCCACAGTGAGGCCCAAGTCAAAGCG
CAGGAGCGGGGAGTTGCCAACGTAGTAATTCCTTTGAGTCATTCTGAGACTATCACCATTGGCTTTGCGCAAGCC
TCATATGAGAAAGTCAAAGTCAGCACCTTTATCTTTCTTTGGTGCGCCAACCTTGCCTCAATTCAGGAAGACCAA
AGGAGGATCTTACATCCTCTCAGCGCTGGACATTTCTCTGCCTCATTCTGTGTAGGCTACGCTCAGGGGAATGTC
ACGTGCCATCATATGTCACGTTCTGCCCATCCCAACTTCCTCCGTACTCCGCATCCGCACTGTTTGAATCTCTTT
CATTGTCTCAGTGCCCGTGCCTCGGTCGCCCACTCCTGTTCCTCTACCTGTGTGGCTGTCTATGGCGTCACCCCT
GCCTAA
Gene >AgabiH97|050390
ATGATTGCTATGCTCGCTTCCACATTCTTGCGTTCCACCTTGAACGTTATCCAAGCTGGTGTTATGTCTTCCTTT
GGTTTCGGTCAAGTTGGTGGAACAGCCCTTGTTGTACATCCTCGCTACCTCTTTGGTGCTCTCGAACTGAATTTC
TATGAGCAATACAAGGAAAGAAACCGCACTCGTGCACTCCAGTCCTACAAGGCCATGAGTGACATGATGGTCAAA
AACTCGCTCGTGAAGATCAAGGAATACCCACCATTCACACCCGAAAACGAACAAGAAGTACTCATGAACTCGATG
GCGCGTGTCACTTGTGATCCCAAGACTGGCGAATATTATTTCAAGGGCAAGCTTCCTAGAGAGGCGCCCCTCAAT
CTATCATCTCAAACTTGTATCTGACGTCATGACCGCTCCCTCTGCTGCTATGAACAGCAATATCATTGGCGTTGG
TGTTGACCGGTGATAATTTCCCCAATCTTTACAAGTCGTACCATCTCATTCGTGTTTGCAGAGCTTATCACATCT
GTTTCCTCGCACAATCCCACATTTGTTGCTCCCAACTTCACTGAGGCGGAAACAGCTTACTGTCGCGCTCAACCT
TCGCCTGCATCCTCATTCGCAGCTCTCTGGGTTGGAAAGGAAGCTGTCTTCAAATCCCTTGACGTCGAGTCGGCA
GGAGCTGCAGCTGTTCTGAAAGATATTGAGATTCTCAACGATGATACCGGTGTTCCCTCTGTTCATCTCCACAGT
GAGGCCCAAGTCAAAGCGCAGGAGCGGGGAGTTGCCAACGTAGTAATTCCTTTGAGTCATTCTGAGGTTAGTCGT
GCCCACGAAGTCCTTTTTTGCGTTTATCCTAACTTGGATATCTAGACTATCACCATTGGCTTTGCGCAAGCCTCA
TATGAGAAAGTCAAAGTCAGCACCTTTATCTTTCTTTGGTGCGCCAACCTTGCCTCAATTCAGGAAGACCAAAGG
AGGATCTTACATCCTCTCAGCGCTGGACATTTCTCTGCCTCATTCTGTGTAGGCTACGCTCAGGGGAATGTCACG
TGCCATCATATGTCACGTTCTGCCCATCCCAACTTCCTCCGTACTCCGCATCCGCACTGTTTGAATCTCTTTCAT
TGTCTCAGTGCCCGTGCCTCGGTCGCCCACTCCTGTTCCTCTACCTGTGTGGCTGTCTATGGCGTCACCCCTGCC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail