Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|050250
Gene name
Locationscaffold_2:2883541..2885018
Strand-
Gene length (bp)1477
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10282 Lactonase Lactonase, 7-bladed beta-propeller 5.0E-53 66 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34499|6PGL_BACSU 6-phosphogluconolactonase OS=Bacillus subtilis (strain 168) GN=pgl PE=1 SV=1 61 388 4.0E-15
sp|O86281|Y2431_LACLM Uncharacterized protein llmg_2431 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=llmg_2431 PE=3 SV=2 65 375 5.0E-14
sp|Q49YW6|Y869_STAS1 Uncharacterized protein SSP0869 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0869 PE=3 SV=1 75 409 5.0E-12
sp|Q8CRT1|Y1604_STAES Uncharacterized protein SE_1604 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1604 PE=3 SV=1 75 404 6.0E-12
sp|Q5HN15|Y1457_STAEQ Uncharacterized protein SERP1457 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1457 PE=3 SV=1 75 404 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34499|6PGL_BACSU 6-phosphogluconolactonase OS=Bacillus subtilis (strain 168) GN=pgl PE=1 SV=1 61 388 4.0E-15
sp|O86281|Y2431_LACLM Uncharacterized protein llmg_2431 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=llmg_2431 PE=3 SV=2 65 375 5.0E-14
sp|Q49YW6|Y869_STAS1 Uncharacterized protein SSP0869 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0869 PE=3 SV=1 75 409 5.0E-12
sp|Q8CRT1|Y1604_STAES Uncharacterized protein SE_1604 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1604 PE=3 SV=1 75 404 6.0E-12
sp|Q5HN15|Y1457_STAEQ Uncharacterized protein SERP1457 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1457 PE=3 SV=1 75 404 6.0E-12
sp|O86271|YWCC_LACLA Uncharacterized protein YwcC OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ywcC PE=3 SV=1 65 375 2.0E-11
sp|Q99SW6|Y1921_STAAM Uncharacterized protein SAV1921 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1921 PE=3 SV=1 75 388 9.0E-11
sp|Q7A4P4|Y1737_STAAN Uncharacterized protein SA1737 OS=Staphylococcus aureus (strain N315) GN=SA1737 PE=1 SV=1 75 388 9.0E-11
sp|D4B0N9|6PGL_ARTBC Probable 6-phosphogluconolactonase ARB_02015 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02015 PE=1 SV=1 48 412 1.0E-10
sp|Q2FWX8|Y2143_STAA8 Uncharacterized protein SAOUHSC_02143 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02143 PE=3 SV=1 75 388 2.0E-10
sp|Q2YU76|Y1858_STAAB Uncharacterized protein SAB1858c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1858c PE=3 SV=1 123 388 2.0E-10
sp|Q6G811|Y1845_STAAS Uncharacterized protein SAS1845 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1845 PE=3 SV=1 123 388 2.0E-10
sp|Q8NVS2|Y1862_STAAW Uncharacterized protein MW1862 OS=Staphylococcus aureus (strain MW2) GN=MW1862 PE=3 SV=1 75 388 2.0E-10
sp|Q2FFH4|Y1902_STAA3 Uncharacterized protein SAUSA300_1902 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1902 PE=3 SV=1 75 388 2.0E-10
sp|Q5HEJ8|Y1985_STAAC Uncharacterized protein SACOL1985 OS=Staphylococcus aureus (strain COL) GN=SACOL1985 PE=3 SV=1 75 388 2.0E-10
sp|Q6GFD5|Y2014_STAAR Uncharacterized protein SAR2014 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2014 PE=3 SV=1 75 388 2.0E-10
sp|O59681|YBS1_SCHPO Uncharacterized protein C18E5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18E5.01 PE=3 SV=1 78 325 3.0E-10
sp|Q4L7N4|Y1032_STAHJ Uncharacterized protein SH1032 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1032 PE=3 SV=1 88 388 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|050250
MVLFYRPRRNIGSKEVLAGRSKFKCTSCPYSFLSVSDNRSSDLVLLFLLSLIRGRQRTIAMTQYQILVSSFTEEI
YTLLFDDSKGTLGLVSKVQVGHHPSWITFHPKDRSVVFAGLEQSDGKVAELKFDQHGKGEVVGKVESGGRDPCSL
LATKDELLVANYSSGVIRIIALADSTPYLTSSSRTIQFSGSGPNKERQEGSHPHQVVIIDDREELLVPDLGADRV
LRFKKGTDGDWNPCGHIQYELGGGPRHIAYCNGELFTLLELSSKVARHSFSPNLGSPEFITSTATMSSPLPQPND
MLAAEILVPQPNSSFPTPYIYLSNRNDPSPAGDIISIFDFTSDPNKLQLIAEVRSGLKHVRAISFGGPDDKYLLA
GGVSGGGVKVFERIDGGKGLKEVAKNEGVVAPTGFLWK*
Coding >AgabiH97|050250
ATGGTTCTCTTTTACAGGCCCCGGCGAAACATCGGGAGTAAAGAGGTATTGGCTGGAAGGTCCAAGTTCAAGTGT
ACAAGCTGTCCTTACTCTTTCTTGTCCGTCTCCGACAACCGGTCTTCCGATCTAGTCCTCCTATTCCTTTTGAGT
CTGATCCGTGGTCGACAAAGAACCATAGCGATGACACAATATCAGATTTTGGTGTCGTCGTTCACTGAAGAAATT
TATACCCTCTTGTTCGACGATAGTAAAGGCACCTTGGGCCTGGTTTCTAAGGTTCAAGTGGGCCATCACCCTTCT
TGGATTACTTTTCACCCGAAAGATCGCTCGGTTGTATTTGCTGGGCTCGAACAATCCGATGGTAAGGTTGCCGAG
CTGAAATTCGATCAACATGGAAAGGGAGAGGTTGTCGGTAAAGTCGAGAGTGGTGGGAGGGATCCCTGCTCACTG
TTGGCCACCAAAGACGAGCTGTTGGTTGCAAATTATTCATCCGGTGTTATAAGAATTATTGCCCTCGCGGACTCA
ACTCCGTACCTCACATCTTCCTCCAGAACAATTCAGTTCTCGGGCTCCGGACCGAATAAAGAGCGTCAAGAGGGC
TCACACCCGCATCAGGTTGTCATAATCGACGACCGGGAGGAGCTCCTTGTCCCTGATCTTGGTGCCGACCGTGTA
CTTCGTTTCAAGAAAGGCACCGATGGTGATTGGAATCCGTGCGGTCACATCCAATATGAATTAGGTGGAGGTCCT
CGTCACATTGCCTACTGCAATGGCGAGCTTTTTACACTCCTTGAACTCTCGAGTAAAGTCGCTCGCCACAGCTTC
TCTCCTAACCTTGGCTCCCCTGAATTCATAACTTCGACCGCTACGATGTCTTCTCCTCTCCCCCAACCCAATGAC
ATGCTGGCAGCAGAAATCCTTGTCCCACAACCAAATTCTTCTTTCCCTACCCCTTATATCTATCTCTCGAACCGA
AACGATCCTTCTCCGGCAGGAGATATCATCTCCATATTCGACTTTACTTCCGATCCTAACAAGCTGCAGCTGATA
GCTGAAGTCAGGTCGGGATTGAAGCACGTTAGGGCAATATCATTCGGTGGACCAGATGACAAATATCTGTTGGCT
GGTGGTGTGAGCGGAGGTGGTGTTAAAGTGTTTGAAAGGATTGATGGTGGGAAGGGATTGAAGGAGGTTGCTAAG
AATGAGGGCGTTGTTGCTCCCACCGGGTTCTTGTGGAAGTAA
Transcript >AgabiH97|050250
ATGGTTCTCTTTTACAGGCCCCGGCGAAACATCGGGAGTAAAGAGGTATTGGCTGGAAGGTCCAAGTTCAAGTGT
ACAAGCTGTCCTTACTCTTTCTTGTCCGTCTCCGACAACCGGTCTTCCGATCTAGTCCTCCTATTCCTTTTGAGT
CTGATCCGTGGTCGACAAAGAACCATAGCGATGACACAATATCAGATTTTGGTGTCGTCGTTCACTGAAGAAATT
TATACCCTCTTGTTCGACGATAGTAAAGGCACCTTGGGCCTGGTTTCTAAGGTTCAAGTGGGCCATCACCCTTCT
TGGATTACTTTTCACCCGAAAGATCGCTCGGTTGTATTTGCTGGGCTCGAACAATCCGATGGTAAGGTTGCCGAG
CTGAAATTCGATCAACATGGAAAGGGAGAGGTTGTCGGTAAAGTCGAGAGTGGTGGGAGGGATCCCTGCTCACTG
TTGGCCACCAAAGACGAGCTGTTGGTTGCAAATTATTCATCCGGTGTTATAAGAATTATTGCCCTCGCGGACTCA
ACTCCGTACCTCACATCTTCCTCCAGAACAATTCAGTTCTCGGGCTCCGGACCGAATAAAGAGCGTCAAGAGGGC
TCACACCCGCATCAGGTTGTCATAATCGACGACCGGGAGGAGCTCCTTGTCCCTGATCTTGGTGCCGACCGTGTA
CTTCGTTTCAAGAAAGGCACCGATGGTGATTGGAATCCGTGCGGTCACATCCAATATGAATTAGGTGGAGGTCCT
CGTCACATTGCCTACTGCAATGGCGAGCTTTTTACACTCCTTGAACTCTCGAGTAAAGTCGCTCGCCACAGCTTC
TCTCCTAACCTTGGCTCCCCTGAATTCATAACTTCGACCGCTACGATGTCTTCTCCTCTCCCCCAACCCAATGAC
ATGCTGGCAGCAGAAATCCTTGTCCCACAACCAAATTCTTCTTTCCCTACCCCTTATATCTATCTCTCGAACCGA
AACGATCCTTCTCCGGCAGGAGATATCATCTCCATATTCGACTTTACTTCCGATCCTAACAAGCTGCAGCTGATA
GCTGAAGTCAGGTCGGGATTGAAGCACGTTAGGGCAATATCATTCGGTGGACCAGATGACAAATATCTGTTGGCT
GGTGGTGTGAGCGGAGGTGGTGTTAAAGTGTTTGAAAGGATTGATGGTGGGAAGGGATTGAAGGAGGTTGCTAAG
AATGAGGGCGTTGTTGCTCCCACCGGGTTCTTGTGGAAGTAA
Gene >AgabiH97|050250
ATGGTTCTCTTTTACAGGCCCCGGCGAAACATCGGGAGTAAAGAGGTATTGGCTGGTATTGGAGGCCCTCCAAAT
TAGTGGAGAGTATGGTAGCGGCACCCGTGGCTTCGAATATGTTATATAAGGAAGGTCCAAGTTCAAGTGTACAAG
CTGTCCTTACTCTTTCTTGTCCGTCTCCGACAACCGGTCTTCCGATCTAGTCCTCCTATTCCTTTTGAGTCTGAT
CCGTGGTCGACAAAGGTCCCTTTTTCATATCCTTTTTAACGTCATACCGACCAATTCTGCAGAACCATAGCGATG
ACACAATATCAGATTTTGGTGTCGTCGTTCACTGAAGAAATTTATACCCTCTTGTTCGACGATAGTAAAGGCACC
TTGGGCCTGGTTTCTAAGGTTCAAGTGGGCCATCACCCTTCTTGGATTACTTTTCACCCGAAAGATCGCTCGGTT
GTATTTGCTGGGCTCGAACAATCCGATGGTAAGGTTGCCGAGCTGAAATTCGATCAACATGGAAAGGGAGAGGTT
GTCGGTAAAGTCGAGAGTGGTGGGAGGGATCCCTGCTCACTGTTGGCCACCAAAGACGAGCTGTTGGTTGCAAAT
GTGAGTCCGAGGAAGAATTATCGCACTGGTAGCATTCAAGTACTGAAGAAAGTCTCACATGGCAGTATTCATCCG
GTGTTATAAGAATTATTGCCCTCGCGGACTCAACTCCGTACCTCACATCTTCCTCCAGAACAATTCAGTTCTCGG
GCTCCGGACCGAATAAAGAGCGTCAAGAGGGCTCACACCCGCATCAGGTTGTCATAATCGACGACCGGGAGGAGC
TCCTTGTCCCTGATCTTGGTGCCGACCGTGTACTTCGTTTCAAGAAAGGCACCGATGGTGATTGGAATCCGTGCG
GTCACATCCAATATGAATTAGGTGGAGGTCCTCGTCACATTGCCTACTGCAGTGGGTTTCATCGCTTTTTATCGG
CTGAAAAATCACTTACCCATCGACGACAGATGGCGAGCTTTTTACACTCCTTGAACTCTCGAGTAAAGTCGCTCG
CCACAGCTTCTCTCCTAACCTTGGCTCCCCTGAATTCATAACTTCGACCGCTACGATGTCTTCTCCTCTCCCCCA
ACCCAATGACATGCTGGCAGCAGAAATCCTTGTCCCACAACCAAATTCTTCTTTCCCTACCCCTTATATCTATCT
CTCGAACCGAAACGATCCTTCTCCGGCAGGAGATATCATCTCCATATTCGACTTTACTTCCGATCCTAACAAGCT
GCAGCTGATAGCTGAAGTCAGGTCGGGATTGAAGCACGTTAGGGCAATATCATTCGGTGGACCAGATGACAAATA
TCTGTTGGCTGGTGGTGTGAGCGGAGGTGGTGTTAAAGTGTTTGAAAGGATTGATGGTGGGAAGGGATTGAAGGA
GGTTGCTAAGAATGAGGGCGTTGTTGCTCCCACCGGGTTCTTGTGGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail