Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|050190
Gene name
Locationscaffold_2:2867104..2869945
Strand-
Gene length (bp)2841
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-27 165 532

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 113 578 4.0E-57
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 132 607 4.0E-57
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 134 579 1.0E-55
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 109 592 3.0E-53
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 149 605 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 113 578 4.0E-57
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 132 607 4.0E-57
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 134 579 1.0E-55
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 109 592 3.0E-53
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 149 605 1.0E-48
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 142 607 4.0E-41
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 104 607 1.0E-30
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 113 607 5.0E-29
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 149 605 1.0E-28
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 106 606 7.0E-27
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 135 557 6.0E-26
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 149 390 2.0E-25
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 149 433 3.0E-22
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 149 578 5.0E-22
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 144 419 5.0E-21
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 149 366 1.0E-20
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 142 605 9.0E-20
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 137 356 7.0E-19
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 132 605 2.0E-17
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 110 564 4.0E-15
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 137 363 6.0E-12
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 150 440 3.0E-10
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 148 592 4.0E-10
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 231 381 9.0E-10
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 151 533 8.0E-09
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 109 390 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 158 177 19
2 197 219 22
3 222 244 22
4 250 272 22
5 285 307 22
6 322 341 19
7 386 408 22
8 428 450 22
9 457 476 19
10 481 503 22
11 515 537 22
12 552 571 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|050190
MDERKPIWGGQRQSDPFGFQFMHKKPGLVNLLWQGYFLRVIWRRKAAKPDRLEEKLTILQELRSVLYRSHAVCGG
KTPTTAHGFQGYYDKPEVAMDRYSNEASILSSLVEPMEKNFIPSDLKENIDIEVKHDDVQVESTLLEEIDPVAER
KLVRKLDLILLPMFCLIYCVNFVDRTAVGNAKIAGLEADLGMKGLDFNIALTVFYIFFTVIEVPSNLVLKRVGSI
WVAYLVIAFGAVALGSAFMKTYAHMLVTRVFLGIAEGGTLAGLVYILARFYRRKELVLRMGFFFGLAPSLAGAFG
GLLASGLLTIGDFGPITRWRKIFFVEGIVTIGIGLCLLVVIPEDIRTTKMLNESERAMAIARVNADAPVKVDGMK
EKSTWKLVLRSFNIWTCVCSMGFLFVNISFQGLSLFLPTVINSLGDFTVVQAQLRTVPCYLVGAVWSIFNCYLSW
YLNSRGIAVIVCMLSQTLGYAMAVGTENPHARYAACFFSIMGGTPSGPLFLTWGADNAAPDTMRAVATAAIPGIG
ALGAVIAVWTYLPDDSPNFLKGNSINLAAAITVIMFTGVGMWYLWHENKKRDQGGRDYRLEGKTKEEIRDLGYRH
PNFRYQL*
Coding >AgabiH97|050190
ATGGACGAGCGGAAGCCGATCTGGGGAGGACAACGGCAGTCTGATCCCTTCGGGTTTCAATTTATGCACAAGAAG
CCTGGTCTGGTCAACTTACTTTGGCAAGGATATTTTCTCCGTGTCATCTGGCGCCGTAAAGCCGCCAAACCCGAC
AGGCTTGAGGAAAAGTTGACAATCTTGCAGGAGTTGCGGAGTGTATTATATCGTTCACATGCCGTTTGCGGCGGG
AAAACACCCACGACCGCTCATGGGTTCCAAGGGTATTATGACAAGCCAGAGGTGGCTATGGACAGGTACAGCAAT
GAGGCTTCCATTCTTTCTTCCCTTGTCGAGCCCATGGAAAAGAATTTTATCCCAAGCGACCTGAAAGAGAATATC
GACATCGAGGTCAAACATGACGATGTTCAAGTCGAAAGTACACTGCTGGAAGAAATTGACCCGGTTGCTGAAAGA
AAGCTTGTGCGCAAACTAGACCTCATCTTGCTACCGATGTTCTGCTTAATCTACTGCGTAAACTTTGTCGACAGA
ACCGCTGTGGGCAATGCTAAGATTGCAGGTCTCGAAGCCGACCTCGGCATGAAAGGACTCGACTTCAATATTGCG
CTAACCGTGTTCTATATTTTTTTTACTGTCATTGAAGTACCATCAAATCTGGTTCTCAAGCGGGTCGGGTCTATC
TGGGTCGCATATTTGGTCATTGCGTTCGGGGCAGTAGCATTAGGATCTGCTTTCATGAAGACCTACGCGCATATG
CTGGTGACAAGGGTATTTTTGGGAATCGCAGAAGGCGGAACATTGGCCGGACTTGTCTACATCTTGGCGCGGTTT
TACCGCCGCAAGGAGCTTGTTCTGCGCATGGGATTCTTTTTTGGCCTGGCCCCAAGCCTTGCGGGAGCCTTTGGA
GGACTACTTGCCTCAGGGCTTTTGACTATCGGGGATTTTGGTCCCATCACACGTTGGAGGAAGATCTTTTTTGTT
GAGGGTATCGTCACCATTGGTATCGGTCTTTGTTTGCTGGTCGTCATACCAGAAGACATACGTACAACAAAAATG
TTGAACGAGTCTGAGCGAGCAATGGCAATTGCGAGAGTCAATGCTGATGCGCCGGTTAAAGTTGATGGAATGAAA
GAAAAGTCAACTTGGAAACTCGTCCTCCGTTCTTTCAATATCTGGACCTGTGTGTGCTCAATGGGCTTCCTTTTC
GTAAATATCTCATTCCAGGGACTGAGTCTATTTCTGCCAACTGTGATAAATTCTCTTGGCGACTTCACGGTCGTT
CAAGCACAACTAAGGACAGTACCCTGTTATCTCGTCGGCGCGGTCTGGTCGATTTTCAATTGCTACTTGAGTTGG
TACCTAAATAGCCGAGGTATCGCAGTCATCGTTTGTATGCTGTCTCAAACGCTAGGATATGCTATGGCCGTTGGT
ACCGAAAATCCTCATGCACGTTATGCTGCTTGTTTCTTTTCTATCATGGGTGGAACTCCTTCTGGTCCTTTGTTT
CTCACTTGGGGTGCAGATAATGCAGCGCCAGATACTATGCGTGCTGTCGCGACTGCCGCTATCCCTGGAATTGGT
GCATTGGGCGCAGTCATTGCTGTCTGGACATATCTTCCTGATGACTCGCCCAACTTCCTTAAGGGTAACTCCATC
AATCTGGCAGCCGCGATAACAGTCATTATGTTCACTGGAGTCGGTATGTGGTATTTATGGCATGAGAATAAGAAG
CGAGATCAAGGGGGAAGGGACTACCGGTTGGAGGGAAAGACTAAGGAAGAGATAAGGGATTTGGGCTATAGACAC
CCTAATTTCCGGTACCAACTGTGA
Transcript >AgabiH97|050190
ATGGACGAGCGGAAGCCGATCTGGGGAGGACAACGGCAGTCTGATCCCTTCGGGTTTCAATTTATGCACAAGAAG
CCTGGTCTGGTCAACTTACTTTGGCAAGGATATTTTCTCCGTGTCATCTGGCGCCGTAAAGCCGCCAAACCCGAC
AGGCTTGAGGAAAAGTTGACAATCTTGCAGGAGTTGCGGAGTGTATTATATCGTTCACATGCCGTTTGCGGCGGG
AAAACACCCACGACCGCTCATGGGTTCCAAGGGTATTATGACAAGCCAGAGGTGGCTATGGACAGGTACAGCAAT
GAGGCTTCCATTCTTTCTTCCCTTGTCGAGCCCATGGAAAAGAATTTTATCCCAAGCGACCTGAAAGAGAATATC
GACATCGAGGTCAAACATGACGATGTTCAAGTCGAAAGTACACTGCTGGAAGAAATTGACCCGGTTGCTGAAAGA
AAGCTTGTGCGCAAACTAGACCTCATCTTGCTACCGATGTTCTGCTTAATCTACTGCGTAAACTTTGTCGACAGA
ACCGCTGTGGGCAATGCTAAGATTGCAGGTCTCGAAGCCGACCTCGGCATGAAAGGACTCGACTTCAATATTGCG
CTAACCGTGTTCTATATTTTTTTTACTGTCATTGAAGTACCATCAAATCTGGTTCTCAAGCGGGTCGGGTCTATC
TGGGTCGCATATTTGGTCATTGCGTTCGGGGCAGTAGCATTAGGATCTGCTTTCATGAAGACCTACGCGCATATG
CTGGTGACAAGGGTATTTTTGGGAATCGCAGAAGGCGGAACATTGGCCGGACTTGTCTACATCTTGGCGCGGTTT
TACCGCCGCAAGGAGCTTGTTCTGCGCATGGGATTCTTTTTTGGCCTGGCCCCAAGCCTTGCGGGAGCCTTTGGA
GGACTACTTGCCTCAGGGCTTTTGACTATCGGGGATTTTGGTCCCATCACACGTTGGAGGAAGATCTTTTTTGTT
GAGGGTATCGTCACCATTGGTATCGGTCTTTGTTTGCTGGTCGTCATACCAGAAGACATACGTACAACAAAAATG
TTGAACGAGTCTGAGCGAGCAATGGCAATTGCGAGAGTCAATGCTGATGCGCCGGTTAAAGTTGATGGAATGAAA
GAAAAGTCAACTTGGAAACTCGTCCTCCGTTCTTTCAATATCTGGACCTGTGTGTGCTCAATGGGCTTCCTTTTC
GTAAATATCTCATTCCAGGGACTGAGTCTATTTCTGCCAACTGTGATAAATTCTCTTGGCGACTTCACGGTCGTT
CAAGCACAACTAAGGACAGTACCCTGTTATCTCGTCGGCGCGGTCTGGTCGATTTTCAATTGCTACTTGAGTTGG
TACCTAAATAGCCGAGGTATCGCAGTCATCGTTTGTATGCTGTCTCAAACGCTAGGATATGCTATGGCCGTTGGT
ACCGAAAATCCTCATGCACGTTATGCTGCTTGTTTCTTTTCTATCATGGGTGGAACTCCTTCTGGTCCTTTGTTT
CTCACTTGGGGTGCAGATAATGCAGCGCCAGATACTATGCGTGCTGTCGCGACTGCCGCTATCCCTGGAATTGGT
GCATTGGGCGCAGTCATTGCTGTCTGGACATATCTTCCTGATGACTCGCCCAACTTCCTTAAGGGTAACTCCATC
AATCTGGCAGCCGCGATAACAGTCATTATGTTCACTGGAGTCGGTATGTGGTATTTATGGCATGAGAATAAGAAG
CGAGATCAAGGGGGAAGGGACTACCGGTTGGAGGGAAAGACTAAGGAAGAGATAAGGGATTTGGGCTATAGACAC
CCTAATTTCCGGTACCAACTGTGA
Gene >AgabiH97|050190
ATGGACGAGCGGAAGCCGATCTGGGGAGGACAACGGCAGTCTGATCCCTTCGGGTTTCAATTTATGCACAAGAAG
CCTGGTCTGGTCAACTTACTTTGGCAAGGATATTTTCTCCGTGTCATCTGGCGCCGTAAAGCCGCCAAACCCGAC
AGGCTTGAGGAAAAGTTGACAATCTTGCAGTGGGCAACTCAAATCAGGACACTTTTGTCGGGACTCTCGTTAACT
TTGAAAGGCTAGGGAGTTGCGGAGTGTATTATATCGTTCACATGCCGTTTGCGGCGGGAAAACACCCACGACCGT
ATCTTCGATTCGACGAACCCATGTGATGATGCGGACACTAGCATCGAGAATGACTTAACTTGGATATAGGCTCAT
GGGTTCCAAGGGTATTATGACAAGCCAGAGGTGGCTAGTAAGTGCTTGGCGGATCATGCATATCGTGATACTGAT
ATATATATAATAGTGGACAGGTACAGCAATGAGGCTTCCATTCTTTCTTCCCTTGTCGAGCCCATGGAAAAGAAT
TTTATCCCAAGCGACCTGAAAGAGAATATCGACATCGAGGTCAAACATGACGATGTTCAAGTCGAAAGTACACTG
CTGGAAGAAATTGACCCGGTTGCTGAAAGAAAGCTTGTGCGCAAACTAGACCTCATCTTGCTACCGATGTTCTGC
TTAATCTGTAAGCTCATGACTCCCGTTGAGATCCGTTTTCTAATCTGTACTATCTCAATAGACTGCGTAAACTTT
GTCGACAGGTACGCTCCATTTGACTGCGCATGCATTTGCAATAGACTGACTTGAGCTCTGTAGAACCGCTGTGGG
TGCGTGAAACTGTGGAATTTACAGCCTGATATCGTCATTTTGATACTCAGGCACACATTGAATAGGCAATGCTAA
GATTGCAGGTCCGCGGTCGAGTGTTACTCCGATAATTTGAAGACTGACATTTGGAATCTCAGGTCTCGAAGCCGA
CCTCGGCATGAAAGGACTCGACTTCAATATTGCGCTAACCGTGTTCTATATTTTTGTATGTCATCTTTTCATTTA
ATGGTATCAGCCCATGTGTCTGATGCATTCGATAGTTTACTGTCATTGAAGTACCATCAAATCTGGTTCTCAAGC
GGGTCGGGTCTATCTGGGTCGCATATTTGGTCATTGCGTTCGGGGCAGTAGCATTAGGATCTGCTTTCATGAAGA
CCTACGCGCATATGCTGGTGACAAGGGTATTTTTGGGAATCGCAGAAGGCGGAACATTGGTAATTCCTTTCTGCA
TCTACACCTTGGCGGTGGACGCTTATGGGTGGATATTGACAGGCCGGACTTGTCTACATCTTGGCGCGGGTAAGG
CGGTAGCATCACATGGCTTTGAAGTTAACTTTTACTTACTTCAATTCAGTTTTACCGCCGCAAGGAGCTTGTTCT
GCGCATGGGATTCTTTTTTGGCCTGGCCCCAAGCCTTGCGGGAGCCTGTGAGTATCTAGTCTTTGTCGGTGTTGT
CATGCATACCAATCGGATATCCATCTAGTTGGAGGACTACTTGCCTCAGGGCTTTTGACTATCGGGGATTTTGGT
CCCATCACACGTTGGAGGAAGGTGAGTTGCCAAGATTCAGACAAAGAACCAAATAACGGAAGCTTTAATAGATCT
TTTTTGTTGAGGGTAAACAGTTCCCATTTCATTCCATAGATGTCCTAAAATACATTTTTTTGCAGGTATCGTCAC
CATTGGTATCGGTCTTTGTTTGCTGGTCGTCATACCAGAAGACATACGTACAACAAAAATGTTGAACGAGTCTGA
GCGAGCAATGGCAATTGCGAGAGTCAATGCTGATGCGCCGGTTAAAGTTGATGGAATGAAAGAAAAGTCAACTTG
GAAACTCGTCCTCCGTTCTTTCAATATCTGGGTATAACGTCCATCTTTGCTTTATACCCTTGTTTTTCTGATAAT
TATATATAGACCTGTGTGTGCTCAATGGGCTTCCTTTTCGTAAATATCTCATTCCAGGGACTGAGTCTATTTCTG
CCAACTGTGATAAATTCTCGTGAGTGTTTCCATTCCATAAATAGGCGTTGTTCGAGTTCTCTAACTTTTAGATGC
ATAGTTGGCGACTTCAGTACGTAGCTTTCGGGCCCCATAAACCACCACTTCTCATGAATATATCATCACCAGCGG
TCGTTCAAGCACAACTAAGGACAGTACCCTGTTATCTCGTCGGCGCGGTCTGGTCGATTTTCAATTGCTACTTGA
GTTGGTACCTAAATAGCCGAGGTATCGCAGTCATCGTTTGTATGCTGTCTCAAACGCTAGGATATGCTATGGCCG
TTGGTACCGAAAATCCTCATGCACGTTATGCTGCTTGTTTCTTTTCTATCATGGGTGGAACTCCTTCTGGTCCTT
TGGTAATTCAAACTCCTTGTTCTTGTCTCGCGACTTACAACTATCGATCTTTAGTTTCTCACTTGGGGTGCAGAT
AATGCAGCGCCAGATACTATGCGTGCTGTCGCGACTGCCGCTATCCCTGGAATTGGTGCATTGGGCGCAGTCATT
GCGTAAGTTTGAGTTTTTTGAAGAATTTGAATTCCGTTCTGACGTAGTGATGATTTGCTCAGTGTCTGGACATAT
CTTCCTGATGACTCGCCCAACTTCCTTAAGGGTAACTCCATCAATCTGGCAGCCGCGATAACAGTCATTATGTTC
ACTGGAGTCGGTATGTGGTATTTATGGCATGAGAATAAGAAGCGAGATCAAGGGGGAAGGGACTACCGGTTGGAG
GGAAAGACTAAGGAAGAGATAAGGGATTTGGGCTATAGACACCCTAATTTCCGGTACCAACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail