Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049700
Gene name
Locationscaffold_2:2767274..2771084
Strand-
Gene length (bp)3810
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 2.6E-220 86 602
PF17048 Ceramidse_alk_C Neutral/alkaline non-lysosomal ceramidase, C-terminal 9.8E-56 606 768

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 86 768 0.0E+00
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 86 768 9.0E-174
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 82 768 5.0E-168
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 86 769 9.0E-167
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 61 768 3.0E-164
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 86 768 0.0E+00
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 86 768 9.0E-174
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 82 768 5.0E-168
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 86 769 9.0E-167
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 61 768 3.0E-164
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 83 768 1.0E-162
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 83 768 4.0E-158
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 86 750 3.0E-150
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 86 769 9.0E-150
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 86 750 5.0E-144
sp|Q9I596|NCASE_PSEAE Neutral ceramidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0845 PE=1 SV=1 86 768 3.0E-117
sp|O06769|NCASE_MYCTU Neutral ceramidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0669c PE=1 SV=1 88 768 5.0E-100
sp|P0C7U1|ASA2B_HUMAN Putative inactive neutral ceramidase B OS=Homo sapiens GN=ASAH2B PE=2 SV=1 641 769 6.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049700
MPCYHSQDSENKTRSGNSVKNRVEANIMPLLSYNSALPLDLWDSVESFYNVMRGSFYYLTAFLASSSVFSNGASG
GIGIKGANAQYLLGLGIGDITGPVVETNMMGYASLAQTDTGLHMRQRSRAFIVADASNPDDRIVFINADIAMGDT
GVRRSIVNQLSNQFSGVYTNENIAFVGTHQHSGVGGYLENLLPQVTSLGYVKQTADAIIAGTVLAVQRAHNSLAP
GHLSLGNTTIPDGNINRSPSAYLENPASERARYQFDQDKDMTLLRFDDDSGNARGFLSFFAVHGTSLYENNTLVS
TDNKGMAAYLFESSVEPNTTPGNTTFVAGFTQSNVGDTSPNTLGAFCESPGEDFDGQPCEFQHSTCGGKTQPCHG
RGPGFQVSDFESNRIIGNMQFEAARTIMNGELSPVAGAVKSVHAYMNMAFREFKLPNGTSVSTCPAALGFSFAGG
TTDGPGAFDFVQGDNSSTQNPFWEIVKGAVTPLPSAQQKACQSPKPILLNTGSAHTPYDWSPTTVDVQMLRVGNF
VMLIMPGELTTMAGRRMREALRAKLISSGVLGTDAYVVVAGPANTYAHYVTTPEEYAAQRYEGASTIFGKWTLDS
YIDKYSNMVELLADNATGRPESDEAPNDQTSKAISLQTPVVFDSAPLGKHFGSVLSDVNSSPYRTGETVQVQFVG
ANPRSNLRLEGTFLTVEQQSENGWRIVRTDSHPSTIYRWTRTNQLTGTSTVDISWTIESGTPAGSYRIRYFGDSK
PLIGSVNEFTGTSGVFIVA*
Coding >AgabiH97|049700
ATGCCTTGCTACCATTCACAGGATTCAGAGAACAAGACGAGGTCTGGGAATTCGGTTAAAAACCGTGTGGAGGCC
AATATCATGCCCTTGCTCTCCTACAACAGCGCGTTACCCTTGGACCTTTGGGACAGTGTAGAGTCTTTCTACAAC
GTCATGAGAGGATCTTTCTATTACTTGACCGCATTCCTGGCTTCGTCTTCTGTCTTTTCTAATGGAGCAAGTGGG
GGTATCGGTATCAAAGGAGCGAATGCCCAGTATCTCCTCGGCTTAGGAATTGGGGACATCACAGGTCCTGTCGTC
GAAACCAATATGATGGGGTACGCATCGCTCGCGCAAACGGACACAGGTCTGCACATGAGGCAACGAAGTCGCGCG
TTCATTGTGGCCGACGCTTCGAATCCCGATGATAGGATTGTTTTTATTAACGCTGATATTGCAATGGGTGACACT
GGAGTTCGCCGGTCCATTGTCAATCAATTATCAAATCAATTTTCTGGGGTGTATACGAATGAAAACATCGCATTC
GTTGGCACTCACCAACATTCTGGCGTCGGTGGCTACCTCGAGAACCTCTTGCCTCAAGTTACATCGCTCGGATAT
GTTAAACAAACAGCGGACGCCATTATTGCCGGTACCGTACTTGCCGTGCAACGTGCTCATAACAGTCTTGCTCCC
GGTCATCTGAGCCTTGGAAATACCACCATTCCAGATGGAAATATCAATAGGTCGCCTTCTGCTTACCTCGAGAAC
CCGGCTTCTGAGCGTGCTCGTTATCAATTCGACCAAGACAAGGATATGACCCTCCTGCGTTTTGACGACGACAGC
GGCAACGCTCGAGGATTCTTGAGTTTCTTTGCTGTGCATGGTACAAGCCTATACGAAAATAATACGCTGGTGAGC
ACGGACAACAAAGGAATGGCTGCGTACCTCTTCGAATCATCCGTTGAACCAAATACCACACCCGGTAACACAACC
TTCGTTGCTGGATTTACCCAATCTAATGTCGGCGACACAAGCCCCAATACCCTTGGCGCATTTTGTGAAAGTCCT
GGAGAAGACTTCGACGGGCAGCCATGCGAATTTCAACATTCTACTTGTGGAGGCAAGACTCAACCCTGCCATGGC
CGTGGTCCAGGTTTCCAGGTCTCTGACTTTGAGAGCAATCGTATTATTGGAAATATGCAATTTGAAGCCGCACGG
ACAATCATGAATGGCGAACTCAGCCCTGTCGCTGGGGCTGTGAAGAGTGTCCATGCTTACATGAATATGGCATTC
CGTGAGTTCAAGCTTCCCAACGGAACGTCGGTATCTACATGTCCTGCTGCTCTTGGATTCTCCTTCGCTGGTGGC
ACAACAGACGGCCCTGGGGCATTTGATTTTGTTCAGGGTGACAATTCCAGTACCCAAAATCCATTTTGGGAGATT
GTCAAAGGCGCTGTCACCCCTCTGCCCTCTGCTCAACAAAAGGCGTGCCAGAGCCCTAAACCCATTCTGCTTAAT
ACGGGCTCTGCTCATACCCCATATGATTGGTCGCCAACTACAGTCGATGTTCAAATGTTACGGGTCGGAAACTTC
GTAATGCTGATAATGCCTGGTGAATTGACAACAATGGCCGGAAGGAGAATGAGAGAAGCTCTTCGCGCCAAACTA
ATATCTTCTGGTGTGCTCGGCACGGATGCTTACGTGGTAGTTGCCGGGCCGGCCAATACATACGCGCATTACGTG
ACTACCCCCGAAGAGTATGCGGCTCAACGATACGAGGGCGCCAGTACTATTTTCGGAAAATGGACCCTTGACTCA
TATATTGATAAGTATTCGAACATGGTTGAATTATTGGCGGACAATGCAACTGGAAGACCTGAATCAGACGAAGCC
CCCAATGACCAAACTTCGAAAGCCATTTCGTTACAGACACCCGTCGTCTTTGATTCTGCGCCCCTAGGGAAGCAC
TTTGGTTCCGTACTCTCGGATGTGAACTCTAGTCCGTATCGTACGGGTGAAACAGTCCAGGTTCAATTCGTTGGA
GCGAACCCTCGAAGCAATCTTCGCCTTGAGGGCACTTTTCTCACCGTGGAACAGCAATCCGAAAATGGGTGGCGG
ATAGTAAGAACCGATTCGCATCCATCCACAATCTATCGGTGGACTAGGACCAACCAGCTCACAGGCACGAGCACT
GTTGATATCTCTTGGACAATCGAAAGTGGCACTCCTGCCGGATCGTACCGAATCAGATACTTTGGGGACTCCAAG
CCACTGATTGGCTCAGTGAACGAGTTTACAGGTACTTCGGGTGTGTTCATAGTAGCTTGA
Transcript >AgabiH97|049700
ATGCCTTGCTACCATTCACAGGATTCAGAGAACAAGACGAGGTCTGGGAATTCGGTTAAAAACCGTGTGGAGGCC
AATATCATGCCCTTGCTCTCCTACAACAGCGCGTTACCCTTGGACCTTTGGGACAGTGTAGAGTCTTTCTACAAC
GTCATGAGAGGATCTTTCTATTACTTGACCGCATTCCTGGCTTCGTCTTCTGTCTTTTCTAATGGAGCAAGTGGG
GGTATCGGTATCAAAGGAGCGAATGCCCAGTATCTCCTCGGCTTAGGAATTGGGGACATCACAGGTCCTGTCGTC
GAAACCAATATGATGGGGTACGCATCGCTCGCGCAAACGGACACAGGTCTGCACATGAGGCAACGAAGTCGCGCG
TTCATTGTGGCCGACGCTTCGAATCCCGATGATAGGATTGTTTTTATTAACGCTGATATTGCAATGGGTGACACT
GGAGTTCGCCGGTCCATTGTCAATCAATTATCAAATCAATTTTCTGGGGTGTATACGAATGAAAACATCGCATTC
GTTGGCACTCACCAACATTCTGGCGTCGGTGGCTACCTCGAGAACCTCTTGCCTCAAGTTACATCGCTCGGATAT
GTTAAACAAACAGCGGACGCCATTATTGCCGGTACCGTACTTGCCGTGCAACGTGCTCATAACAGTCTTGCTCCC
GGTCATCTGAGCCTTGGAAATACCACCATTCCAGATGGAAATATCAATAGGTCGCCTTCTGCTTACCTCGAGAAC
CCGGCTTCTGAGCGTGCTCGTTATCAATTCGACCAAGACAAGGATATGACCCTCCTGCGTTTTGACGACGACAGC
GGCAACGCTCGAGGATTCTTGAGTTTCTTTGCTGTGCATGGTACAAGCCTATACGAAAATAATACGCTGGTGAGC
ACGGACAACAAAGGAATGGCTGCGTACCTCTTCGAATCATCCGTTGAACCAAATACCACACCCGGTAACACAACC
TTCGTTGCTGGATTTACCCAATCTAATGTCGGCGACACAAGCCCCAATACCCTTGGCGCATTTTGTGAAAGTCCT
GGAGAAGACTTCGACGGGCAGCCATGCGAATTTCAACATTCTACTTGTGGAGGCAAGACTCAACCCTGCCATGGC
CGTGGTCCAGGTTTCCAGGTCTCTGACTTTGAGAGCAATCGTATTATTGGAAATATGCAATTTGAAGCCGCACGG
ACAATCATGAATGGCGAACTCAGCCCTGTCGCTGGGGCTGTGAAGAGTGTCCATGCTTACATGAATATGGCATTC
CGTGAGTTCAAGCTTCCCAACGGAACGTCGGTATCTACATGTCCTGCTGCTCTTGGATTCTCCTTCGCTGGTGGC
ACAACAGACGGCCCTGGGGCATTTGATTTTGTTCAGGGTGACAATTCCAGTACCCAAAATCCATTTTGGGAGATT
GTCAAAGGCGCTGTCACCCCTCTGCCCTCTGCTCAACAAAAGGCGTGCCAGAGCCCTAAACCCATTCTGCTTAAT
ACGGGCTCTGCTCATACCCCATATGATTGGTCGCCAACTACAGTCGATGTTCAAATGTTACGGGTCGGAAACTTC
GTAATGCTGATAATGCCTGGTGAATTGACAACAATGGCCGGAAGGAGAATGAGAGAAGCTCTTCGCGCCAAACTA
ATATCTTCTGGTGTGCTCGGCACGGATGCTTACGTGGTAGTTGCCGGGCCGGCCAATACATACGCGCATTACGTG
ACTACCCCCGAAGAGTATGCGGCTCAACGATACGAGGGCGCCAGTACTATTTTCGGAAAATGGACCCTTGACTCA
TATATTGATAAGTATTCGAACATGGTTGAATTATTGGCGGACAATGCAACTGGAAGACCTGAATCAGACGAAGCC
CCCAATGACCAAACTTCGAAAGCCATTTCGTTACAGACACCCGTCGTCTTTGATTCTGCGCCCCTAGGGAAGCAC
TTTGGTTCCGTACTCTCGGATGTGAACTCTAGTCCGTATCGTACGGGTGAAACAGTCCAGGTTCAATTCGTTGGA
GCGAACCCTCGAAGCAATCTTCGCCTTGAGGGCACTTTTCTCACCGTGGAACAGCAATCCGAAAATGGGTGGCGG
ATAGTAAGAACCGATTCGCATCCATCCACAATCTATCGGTGGACTAGGACCAACCAGCTCACAGGCACGAGCACT
GTTGATATCTCTTGGACAATCGAAAGTGGCACTCCTGCCGGATCGTACCGAATCAGATACTTTGGGGACTCCAAG
CCACTGATTGGCTCAGTGAACGAGTTTACAGGTACTTCGGGTGTGTTCATAGTAGCTTGA
Gene >AgabiH97|049700
ATGCCTTGTGACGGGCCGGCATATGCTACTCGACTTCGTTCACATCTCTTTCATCAGGCTACCATTCACAGGATT
CAGAGAACAAGACGAGGTCTGGGAATTCGGTTAAAAACCGTGTGGAGGCCAATATCATGCCCTTGCTCTCCTACA
ACAGCGCGTTACCCTTGGACCTTTGGGACAGTGTAGAGTCTTTCTACAACGTCATGAGAGGATCTTTCTATTACT
TGACCGCATTCCTGGCTTCGTCTTCTGTCTTTTCTAATGGAGCAAGTGGGGGTATCGGTATCAAAGGAGCGAATG
CCCAGTATCTCCTCGGCTTAGGTCAGTAAACCTATTCAGAACCAGGAGGACATTCGCGCATTGATGACGATCATT
TTAGGAATTGGGGACATCACAGGGTGGGTCATTGAAAAAAATCCCCGTTTTAATCGTCGAACTGTGCTAAAATAT
GACGAAGTCCTGTCGTCGAAACCAATATGATGGTATGCCAACTAATAAGGAAATGTTATGATCTATGTTGATGTC
ATACGTACGATAGGGGTACGCATCGCTCGCGCAAACGGACACAGGTCTGCACATGAGGCAACGAAGTCGCGCGTT
CATTGTGGCCGACGCTTCGAATCCCGATGATAGGATTGTTTTTATTAACGCTGGTAAGTATATTGTTTATGTTTT
CCTTCGTGCGCAAAATCGGAACTTGAAAACCACGATTTCATCTTTCGTCAACTATGCTCTGATGATACTTTGTCT
TTTAGATATTGCAATGGGTGACACTGGAGTTCGCCGGTCCATTGTCAATCAATTATCAAATCAATTTTCTGGGGT
GTATACGAATGAAAACATCGCATTCGTTGGCACTCACCAACATTCTGGCGTCGGTGGCTACCTCGAGAACCTCTT
GCCTCAAGTTACATCGCTCGGATATGTTAAACAAACAGCGGACGCCATTATTGCCGGTACCGTACTTGCCGTGCA
ACGTGCTCATAACAGTCTTGCTCCCGGTCATCTGAGCCTTGGAAATACCACCATTCCAGATGGAAATATCAATAG
GTCGCCTTCTGCTTACCTCGAGAACCCGGCTTCTGAGCGTGCTCGTTATCAATTCGACCAAGACAAGGATATGAC
CCTCCTGCGTTTTGACGACGACAGCGGCAACGCTCGAGGATTCTTGAGTTTCTTTGCTGTGCATGGTACAAGCCT
ATACGAAGTATGAATGAAGTTGCAGATCGTGTTAGAGATGTCTCATATTTTCTTTCGTCCACAGAATAATACGCT
GGTGAGCACGGACAACAAAGGAATGGCTGCGTACCTCTTCGAATGTAAGTCGGATCCATCATACTTACAACATAC
AAATAACGCTGTCTCAGCATCCGTTGAACCAAATACCACACCCGGTAACACAACCTTCGTTGCTGGATTTACCCA
ATGTGAGTTCCTGATGTACGACCTCTGAAAAGTTGGACTAAAACTCTACCGATATTAGCTAATGTCGGCGACACA
AGCCCCAATACGTCCGTTTATTTCATGACCGGAAGAATCGCAACATACTCACACCACTTTTCTAGCCTTGGCGCA
TTTTGTGAAAGTCCTGGAGAAGACTTCGACGGGCAGCCATGCGAATTTCAACATTCTACTTGTGGAGGCAAGACT
CAACCCTGCCATGGCCGGTGTGTGAAGAAGTTATGCTACATTTGCCTACTCACTTTGTCATCATAGTGGTCCAGG
TTTCCAGGTCTCTGACTTTGAGAGCAATCGTATTATTGGAAATATGCAATTTGAAGCCGCACGGACAATCATGAA
TGGCGAACTCAGCCCTGTCGCTGGGGCTGTGAAGAGTGTCCATGCTTACATGAATATGTCAGTCCCCATCTTACA
TAGCGATTCGTTCCCAATCAGCTGTTATAAATCTTAATGCCCTTTTCTTTAGGGCATTCCGTGAGTTCAAGCTTC
CCAACGGAACGTCGGTATCTACATGTCCTGCTGCTCTTGGTGCGATCTGCTTCCCCCGTTTAGTCCATGTTTTTT
AACTGAAGTCTGTTCCAGGATTCTCCTTCGCTGGTGGCACAACGTAAGTACCTTGATCAAGCCGTATTATTTCAC
TTGGCCTAGAACACGTTCTTCAGAGACGGCCCTGGGGCATTTGATTTTGTTCAGGGTGACAATTCCAGTACCCAG
TGAGTTGGCTACATTGATAATTCAAGCCCCTAACGATAAATAATCGTTACATAGAAATCCATTTTGGGAGATTGT
CAAAGGTGTGTTCGAGGTTCATATTATCCGATAAATAGGCTTGTGACGCGAACGTGCACCTTGAAGGCGCTGTCA
CCCCTCTGCCCTCTGCTCAACAAAAGGCGTGCCAGAGCCCTAAACCCATTCTGCTTAATACGGTATGTTTTAGAC
CTGATGTATTGAATATCATGACCAATGACGCCACGTCTCATGATCAGGGCTCTGCTCATACCCCATATGATTGGT
CGCCAACTACAGTCGATGTTCAAATGTTACGGGTCGGAAACTTCGGTGGGTCTCCCACCTGTTTTTCTTCGAGTC
GGCTAACTCTGGCTATCGATTAACCCCTGACAGTAATGCTGATAATGCCTGGCAAGTCTAAATTGATTTTCCGAA
TTCTCTTATGGAACTGATGCTTATATGATGATAGGTGAATTGACAACAATGGCCGGAAGGAGAATGAGGTTCGTT
CATCATTCTCGTTTTTGTTTGCTGCTAACCCTCAACCACCACGATCATCGCCTAAACCAAAATACATTCTCATGG
ATGTCATCGTCTTTAGAGAAGCTCTTCGCGCCAAACTAATATCTTCTGGTGTGCTCGGCACGGATGCTTACGTGG
TAGTTGCCGGGCCGGCCAATACATACGCGCATTACGTGACTACCCCCGAAGAGTATGCGGCTCAACGATACGAGG
GCGCCAGTACTATTTTCGGAAAATGTCAGCGACTGATCCTCCTCTAATTCTCCTCACGGAACAAACGTTCTGACG
ATACTTTCCCTCAGGGACCCTTGACTCATATATTGATAAGTATTCGAACATGGTTGAATTATTGGCGGACAATGC
AACTGGAAGACCTGAATCAGACGAAGCCCCCAATGACCAAACTTCGAAAGCCATTTCGTTACAGGTCAGTTGATC
GTTCCATTTCTTTGGTTTATTGTTTCTCACTGGCTTTATAGACACCCGTCGTCTTTGATTCTGCGCCCCTAGGGA
AGCACTTTGGTTCCGTACTCTCGGATGTGAACTCTAGTCCGTATCGTACGGGTGAAACAGTCCAGGTTCAATTCG
TTGGAGCGAACCCTCGAGTAAGTAGATGTTGGATTAGCCCCCCAATAATTAACACATTTCCCCGCGGGGCTACCC
AGAGCAATCTTCGCCTTGAGGGCACTTTTCTCACCGTGGAACAGCAATCCGAAAATGGGTGGCGGATAGTAAGAA
CCGATTCGCATCCATCCACAATCTATCGGTGGACTAGGACCAACCAGGTAAGGACCGCCCTCACTGCGACCCGGC
GCCTCTGACCCTAATTGTGTTACTTAGCTCACAGGCACGAGCACTGTTGATATCTCTTGGTAGGTTCCTTATTCG
CTTTGACCTTGGCGTAGTGAATTGATGAAATCATAGGACAATCGAAAGTGGCACTCCTGGTAAATGAGTTTTGAA
TTGAAAACGCATCTGAACGCATCTAACGAACCTACAGCCGGATCGTACCGAATCAGATACTTTGGGGACTCCAAG
CCACTGATTGGCTCAGTGAACGAGTTTACAGGTACTTCGGGTGTGTTCATAGTAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail