Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049560
Gene name
Locationscaffold_2:2734837..2736294
Strand-
Gene length (bp)1457
Transcript length (bp)1305
Coding sequence length (bp)1305
Protein length (aa) 435

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 1.6E-10 79 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 79 144 2.0E-12
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 79 144 9.0E-12
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 79 144 1.0E-11
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 79 144 2.0E-11
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 79 144 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 79 144 2.0E-12
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 79 144 9.0E-12
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 79 144 1.0E-11
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 79 144 2.0E-11
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 79 144 3.0E-11
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 79 144 5.0E-11
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 79 144 5.0E-11
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 79 144 6.0E-11
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 76 144 9.0E-11
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|Q57AD6|DNAJ_BRUAB Chaperone protein DnaJ OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|Q2YQV1|DNAJ_BRUA2 Chaperone protein DnaJ OS=Brucella abortus (strain 2308) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|B2S9C2|DNAJ_BRUA1 Chaperone protein DnaJ OS=Brucella abortus (strain S19) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|Q8FXX1|DNAJ_BRUSU Chaperone protein DnaJ OS=Brucella suis biovar 1 (strain 1330) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|B0CJX5|DNAJ_BRUSI Chaperone protein DnaJ OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|Q8YE77|DNAJ_BRUME Chaperone protein DnaJ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|C0RG11|DNAJ_BRUMB Chaperone protein DnaJ OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|A9M9V9|DNAJ_BRUC2 Chaperone protein DnaJ OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dnaJ PE=3 SV=1 79 144 1.0E-10
sp|Q05980|DNAJ_BRUO2 Chaperone protein DnaJ OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaJ PE=2 SV=2 79 144 1.0E-10
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 76 144 1.0E-10
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 79 144 1.0E-10
sp|P26508|NOLC_RHIFR Protein NolC OS=Rhizobium fredii GN=nolC PE=3 SV=1 79 144 2.0E-10
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 79 144 2.0E-10
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 76 144 4.0E-10
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 79 144 6.0E-10
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 76 144 8.0E-10
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 79 144 9.0E-10
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 79 144 1.0E-09
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 76 144 1.0E-09
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 79 144 3.0E-09
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 79 146 3.0E-09
sp|A7IC67|DNAJ_XANP2 Chaperone protein DnaJ OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaJ PE=3 SV=1 79 144 4.0E-09
sp|Q0AKB3|DNAJ_MARMM Chaperone protein DnaJ OS=Maricaulis maris (strain MCS10) GN=dnaJ PE=3 SV=1 79 144 2.0E-08
sp|A7H2C0|DNAJ_CAMJD Chaperone protein DnaJ OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaJ PE=3 SV=1 80 148 2.0E-08
sp|O85213|DNAJ_CAMJE Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaJ PE=3 SV=2 80 148 2.0E-08
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 79 144 2.0E-08
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 79 144 2.0E-08
sp|Q5HTK3|DNAJ_CAMJR Chaperone protein DnaJ OS=Campylobacter jejuni (strain RM1221) GN=dnaJ PE=3 SV=1 80 148 2.0E-08
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 79 144 2.0E-08
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 79 144 2.0E-08
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 79 144 3.0E-08
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 79 144 3.0E-08
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 79 144 3.0E-08
sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 79 150 3.0E-08
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 79 146 3.0E-08
sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 79 150 3.0E-08
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 79 144 4.0E-08
sp|B9KFK6|DNAJ_CAMLR Chaperone protein DnaJ OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaJ PE=3 SV=1 79 148 4.0E-08
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 79 144 4.0E-08
sp|A8FMW6|DNAJ_CAMJ8 Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaJ PE=3 SV=1 80 148 4.0E-08
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 79 149 5.0E-08
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 79 144 5.0E-08
sp|A1W0P5|DNAJ_CAMJJ Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=dnaJ PE=3 SV=1 80 148 6.0E-08
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 79 144 6.0E-08
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 79 144 6.0E-08
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 79 144 6.0E-08
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 79 144 8.0E-08
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 79 148 8.0E-08
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 79 144 8.0E-08
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 79 144 9.0E-08
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 79 144 1.0E-07
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|Q9PQ82|DNAJ_UREPA Chaperone protein DnaJ OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaJ PE=3 SV=1 79 146 1.0E-07
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|A7HZ38|DNAJ_PARL1 Chaperone protein DnaJ OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaJ PE=3 SV=1 79 144 1.0E-07
sp|B2J3J3|DNAJ_NOSP7 Chaperone protein DnaJ OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dnaJ PE=3 SV=1 79 150 1.0E-07
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 76 148 1.0E-07
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 79 143 2.0E-07
sp|Q98PI9|DNAJ_MYCPU Chaperone protein DnaJ OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaJ PE=3 SV=2 79 144 2.0E-07
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 76 148 2.0E-07
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 79 144 2.0E-07
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 79 144 3.0E-07
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 56 146 3.0E-07
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 79 144 3.0E-07
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 79 144 4.0E-07
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 79 148 4.0E-07
sp|P25303|SCJ1_YEAST DnaJ-related protein SCJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCJ1 PE=1 SV=2 79 148 4.0E-07
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 79 144 4.0E-07
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 79 144 4.0E-07
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 75 144 4.0E-07
sp|A8EXP6|DNAJ_RICCK Chaperone protein DnaJ OS=Rickettsia canadensis (strain McKiel) GN=dnaJ PE=3 SV=1 76 148 5.0E-07
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 79 144 5.0E-07
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 79 144 5.0E-07
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 79 144 7.0E-07
sp|Q21CI1|DNAJ_RHOPB Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaJ PE=3 SV=1 80 144 7.0E-07
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 79 144 7.0E-07
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 79 149 8.0E-07
sp|Q7V3Q3|DNAJ_PROMP Chaperone protein DnaJ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaJ PE=3 SV=1 79 143 8.0E-07
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 79 144 8.0E-07
sp|A6VNB0|DNAJ_ACTSZ Chaperone protein DnaJ OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaJ PE=3 SV=1 79 144 8.0E-07
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 79 144 8.0E-07
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 79 144 8.0E-07
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 79 144 9.0E-07
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 79 144 9.0E-07
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 79 144 9.0E-07
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 79 144 9.0E-07
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 75 144 9.0E-07
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 79 143 9.0E-07
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 79 143 9.0E-07
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 76 144 9.0E-07
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 79 144 9.0E-07
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 79 149 1.0E-06
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 79 144 1.0E-06
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 79 144 1.0E-06
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 76 146 1.0E-06
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B3QPW8|DNAJ_CHLP8 Chaperone protein DnaJ OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaJ PE=3 SV=1 76 144 1.0E-06
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 76 144 1.0E-06
sp|A1B4F0|DNAJ_PARDP Chaperone protein DnaJ OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q626I7|DNJ20_CAEBR DnaJ homolog dnj-20 OS=Caenorhabditis briggsae GN=dnj-20 PE=3 SV=1 56 146 1.0E-06
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 79 144 1.0E-06
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q5LWJ5|DNAJ_RUEPO Chaperone protein DnaJ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 76 144 2.0E-06
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|A4SFR5|DNAJ_CHLPM Chaperone protein DnaJ OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaJ PE=3 SV=1 76 144 2.0E-06
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 76 144 2.0E-06
sp|P94319|DNAJ_BRADU Chaperone protein DnaJ OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaJ PE=3 SV=1 80 144 2.0E-06
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 80 149 2.0E-06
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 79 143 2.0E-06
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 79 143 2.0E-06
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 79 152 2.0E-06
sp|Q55505|DNAJ1_SYNY3 Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1 76 144 2.0E-06
sp|Q4UJK6|DNAJ_RICFE Chaperone protein DnaJ OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaJ PE=3 SV=1 76 151 2.0E-06
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 79 144 2.0E-06
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 79 148 2.0E-06
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 79 143 2.0E-06
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 79 143 2.0E-06
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 79 144 2.0E-06
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 79 144 3.0E-06
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q28VY4|DNAJ_JANSC Chaperone protein DnaJ OS=Jannaschia sp. (strain CCS1) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 79 146 3.0E-06
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 75 144 3.0E-06
sp|Q2J319|DNAJ_RHOP2 Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaJ PE=3 SV=1 80 144 3.0E-06
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 75 144 3.0E-06
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 79 144 3.0E-06
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 79 144 3.0E-06
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 80 148 4.0E-06
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 80 148 4.0E-06
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 75 144 4.0E-06
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 79 143 4.0E-06
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 79 149 4.0E-06
sp|B3WEQ6|DNAJ_LACCB Chaperone protein DnaJ OS=Lactobacillus casei (strain BL23) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|Q038N5|DNAJ_LACC3 Chaperone protein DnaJ OS=Lactobacillus casei (strain ATCC 334) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 79 144 4.0E-06
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 80 148 4.0E-06
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 79 144 4.0E-06
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 75 186 4.0E-06
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|B8DQW8|DNAJ_DESVM Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaJ PE=3 SV=1 79 143 4.0E-06
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 79 144 4.0E-06
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 80 148 5.0E-06
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 79 144 5.0E-06
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 80 158 5.0E-06
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 79 144 5.0E-06
sp|C4K111|DNAJ_RICPU Chaperone protein DnaJ OS=Rickettsia peacockii (strain Rustic) GN=dnaJ PE=3 SV=1 76 148 5.0E-06
sp|B1XQF6|DNAJ_SYNP2 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dnaJ PE=3 SV=1 76 143 5.0E-06
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 79 144 5.0E-06
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 79 144 5.0E-06
sp|Q0VST5|DNAJ_ALCBS Chaperone protein DnaJ OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaJ PE=3 SV=1 79 144 5.0E-06
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 79 149 5.0E-06
sp|B0BWH0|DNAJ_RICRO Chaperone protein DnaJ OS=Rickettsia rickettsii (strain Iowa) GN=dnaJ PE=3 SV=1 76 148 5.0E-06
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 79 146 5.0E-06
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 79 146 5.0E-06
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 79 146 5.0E-06
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 79 146 5.0E-06
sp|A8GR21|DNAJ_RICRS Chaperone protein DnaJ OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaJ PE=3 SV=1 76 148 5.0E-06
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 79 144 5.0E-06
sp|Q95KD5|DJC18_MACFA DnaJ homolog subfamily C member 18 OS=Macaca fascicularis GN=DNAJC18 PE=2 SV=1 79 150 5.0E-06
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 79 146 5.0E-06
sp|Q9H819|DJC18_HUMAN DnaJ homolog subfamily C member 18 OS=Homo sapiens GN=DNAJC18 PE=2 SV=1 79 150 5.0E-06
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 79 144 5.0E-06
sp|Q5EA26|DJC18_BOVIN DnaJ homolog subfamily C member 18 OS=Bos taurus GN=DNAJC18 PE=2 SV=1 79 150 5.0E-06
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 79 144 6.0E-06
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 79 144 6.0E-06
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 79 144 6.0E-06
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 79 143 6.0E-06
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 79 143 6.0E-06
sp|Q3AQP5|DNAJ_CHLCH Chaperone protein DnaJ OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaJ PE=3 SV=1 76 144 6.0E-06
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 79 144 6.0E-06
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 79 144 6.0E-06
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 79 146 6.0E-06
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 79 151 6.0E-06
sp|A1BHL1|DNAJ_CHLPD Chaperone protein DnaJ OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaJ PE=3 SV=1 76 144 6.0E-06
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 79 159 6.0E-06
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 79 144 6.0E-06
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 79 144 7.0E-06
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 79 146 7.0E-06
sp|O25890|DNAJ_HELPY Chaperone protein DnaJ OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaJ PE=3 SV=1 79 159 7.0E-06
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 79 144 7.0E-06
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 79 144 7.0E-06
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 79 144 7.0E-06
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 79 144 7.0E-06
sp|O08356|DNAJ_RHOS7 Chaperone protein DnaJ OS=Rhodopseudomonas sp. (strain No.7) GN=dnaJ PE=3 SV=1 80 144 8.0E-06
sp|B3Q973|DNAJ_RHOPT Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaJ PE=3 SV=1 80 144 8.0E-06
sp|Q6NCY3|DNAJ_RHOPA Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaJ PE=3 SV=1 80 144 8.0E-06
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|A4SQ24|DNAJ_AERS4 Chaperone protein DnaJ OS=Aeromonas salmonicida (strain A449) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|B3EE31|DNAJ_CHLL2 Chaperone protein DnaJ OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaJ PE=3 SV=1 76 144 8.0E-06
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|A5CX57|DNAJ_VESOH Chaperone protein DnaJ OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|A9KG87|DNAJ_COXBN Chaperone protein DnaJ OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|B6J7U6|DNAJ_COXB1 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaJ PE=3 SV=1 79 144 8.0E-06
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 79 144 9.0E-06
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 79 144 9.0E-06
sp|Q5FSL4|DNAJ_GLUOX Chaperone protein DnaJ OS=Gluconobacter oxydans (strain 621H) GN=dnaJ PE=3 SV=1 79 148 9.0E-06
sp|B6IZJ1|DNAJ_COXB2 Chaperone protein DnaJ OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaJ PE=3 SV=1 79 144 9.0E-06
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 79 144 9.0E-06
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 79 143 9.0E-06
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 79 144 1.0E-05
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 76 144 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 53 70 17
2 160 182 22
3 192 214 22
4 227 246 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049560
MVSGSALFSLVGWSIVPDFATRQLLTFIHKTLANRLPRYSPPSQGTPAYRQHYAYTFAFVVLGYLLYNMIQSARA
LPPNFYEILGVASHVDENGLKAAFRQFAKWNHPDRPGVGEEGARMFMVVRESFEALKNPAVRFAYDRFGPDVLTW
KTCKTQRDFLYHGILQSSGYHIVTFAVLIFWSTIGKHSPASFWRFLVFSFFLLSELTLVIAPPGHKSIIFGLFSN
RVIFQHILFLHQLFLFFSVALSRVAPLFSSGVDDPRLEKAVLEKTRALASVADREVSIILHTDFHSISPSPAPSN
GRATVPLMTPLPKEETISLLQSLLPKMQDLVIEHNLKKDSGPLRSAWEQAISRGRRLLFSSDPQNDLQSQVKNFW
EAENADITGFSTVDGSAYCVVDGQTEEMNLEPLPSPPRSLSPKHSTNMEKRLSQDISVD*
Coding >AgabiH97|049560
ATGGTCTCTGGCTCTGCGCTGTTCAGTTTGGTGGGCTGGTCTATCGTCCCAGACTTCGCTACTCGCCAACTTCTC
ACTTTCATCCACAAGACTCTCGCAAACAGACTCCCCAGATACTCCCCACCCAGCCAAGGAACCCCCGCATATCGT
CAGCACTATGCCTATACCTTTGCTTTTGTCGTTCTCGGCTATCTTTTGTACAATATGATTCAATCTGCTCGGGCT
CTGCCTCCCAATTTCTATGAGATCCTCGGCGTGGCGTCCCATGTAGATGAAAATGGCTTGAAGGCTGCGTTTAGG
CAGTTTGCAAAGTGGAATCATCCCGATAGGCCTGGTGTTGGAGAGGAGGGTGCTCGTATGTTCATGGTGGTTAGA
GAGAGTTTTGAAGCTCTGAAAAATCCTGCGGTTCGATTTGCGTATGATAGGTTTGGGCCTGACGTGTTGACCTGG
AAAACCTGCAAGACGCAACGCGATTTTCTCTACCATGGTATTCTGCAGTCATCAGGTTATCATATTGTCACCTTT
GCTGTACTTATCTTCTGGTCTACTATCGGAAAACACAGCCCAGCCTCCTTTTGGCGATTCCTCGTCTTTTCGTTC
TTCCTCCTATCCGAGCTCACACTAGTCATTGCTCCCCCTGGGCACAAATCTATCATATTCGGCCTATTTTCCAAT
CGCGTCATTTTTCAACACATCCTCTTCTTGCATCAACTTTTCCTGTTTTTCAGCGTAGCTCTCAGCCGCGTTGCT
CCGCTCTTCTCGTCCGGTGTAGATGATCCACGTTTGGAAAAGGCCGTGTTGGAAAAAACACGAGCTTTGGCTAGC
GTCGCTGACCGCGAAGTCTCAATCATCCTGCACACGGACTTCCATTCTATATCTCCTTCTCCAGCTCCATCCAAT
GGTCGAGCAACGGTTCCTCTCATGACGCCCCTACCCAAAGAGGAAACCATATCACTCTTACAATCCCTCTTACCC
AAAATGCAAGATCTCGTTATCGAGCATAACCTTAAAAAGGATTCCGGTCCACTTCGGAGTGCTTGGGAACAAGCT
ATCTCACGGGGGAGGAGACTTCTTTTTTCTTCTGACCCGCAAAATGATCTGCAGAGCCAAGTGAAGAATTTCTGG
GAAGCGGAAAATGCAGATATCACTGGTTTTTCTACCGTCGATGGGAGTGCTTATTGTGTTGTGGATGGTCAGACT
GAGGAAATGAATCTGGAGCCTTTGCCTTCTCCACCGCGTTCATTGTCGCCTAAACATTCAACAAACATGGAAAAA
CGGCTGTCACAGGATATTTCGGTAGATTAA
Transcript >AgabiH97|049560
ATGGTCTCTGGCTCTGCGCTGTTCAGTTTGGTGGGCTGGTCTATCGTCCCAGACTTCGCTACTCGCCAACTTCTC
ACTTTCATCCACAAGACTCTCGCAAACAGACTCCCCAGATACTCCCCACCCAGCCAAGGAACCCCCGCATATCGT
CAGCACTATGCCTATACCTTTGCTTTTGTCGTTCTCGGCTATCTTTTGTACAATATGATTCAATCTGCTCGGGCT
CTGCCTCCCAATTTCTATGAGATCCTCGGCGTGGCGTCCCATGTAGATGAAAATGGCTTGAAGGCTGCGTTTAGG
CAGTTTGCAAAGTGGAATCATCCCGATAGGCCTGGTGTTGGAGAGGAGGGTGCTCGTATGTTCATGGTGGTTAGA
GAGAGTTTTGAAGCTCTGAAAAATCCTGCGGTTCGATTTGCGTATGATAGGTTTGGGCCTGACGTGTTGACCTGG
AAAACCTGCAAGACGCAACGCGATTTTCTCTACCATGGTATTCTGCAGTCATCAGGTTATCATATTGTCACCTTT
GCTGTACTTATCTTCTGGTCTACTATCGGAAAACACAGCCCAGCCTCCTTTTGGCGATTCCTCGTCTTTTCGTTC
TTCCTCCTATCCGAGCTCACACTAGTCATTGCTCCCCCTGGGCACAAATCTATCATATTCGGCCTATTTTCCAAT
CGCGTCATTTTTCAACACATCCTCTTCTTGCATCAACTTTTCCTGTTTTTCAGCGTAGCTCTCAGCCGCGTTGCT
CCGCTCTTCTCGTCCGGTGTAGATGATCCACGTTTGGAAAAGGCCGTGTTGGAAAAAACACGAGCTTTGGCTAGC
GTCGCTGACCGCGAAGTCTCAATCATCCTGCACACGGACTTCCATTCTATATCTCCTTCTCCAGCTCCATCCAAT
GGTCGAGCAACGGTTCCTCTCATGACGCCCCTACCCAAAGAGGAAACCATATCACTCTTACAATCCCTCTTACCC
AAAATGCAAGATCTCGTTATCGAGCATAACCTTAAAAAGGATTCCGGTCCACTTCGGAGTGCTTGGGAACAAGCT
ATCTCACGGGGGAGGAGACTTCTTTTTTCTTCTGACCCGCAAAATGATCTGCAGAGCCAAGTGAAGAATTTCTGG
GAAGCGGAAAATGCAGATATCACTGGTTTTTCTACCGTCGATGGGAGTGCTTATTGTGTTGTGGATGGTCAGACT
GAGGAAATGAATCTGGAGCCTTTGCCTTCTCCACCGCGTTCATTGTCGCCTAAACATTCAACAAACATGGAAAAA
CGGCTGTCACAGGATATTTCGGTAGATTAA
Gene >AgabiH97|049560
ATGGTCTCTGGCTCTGCGCTGTTCAGTTTGGTGGGCTGGTCTATCGTCCCAGACTTCGCTACTCGCCAACTTCTC
ACTTTCATCCACAAGACTCTCGCAAACAGACTCCCCAGATACTCCCCACCCAGCCAAGGAACCCCCGCATATCGT
CAGCACTATGCCTATACCTTTGCTTTTGTCGTTCTCGGCTATCTTTTGTACAATATGATTCAATCTGCTCGGGCT
CTGCCTCCCAATTTCTATGAGATCCTCGGCGTGGCGTCCCATGTAGATGAAAATGGCTTGAAGGCTGCGTTTAGG
CAGTTTGCAAAGTGGAATCATCCCGATAGGCCTGGTGTTGGAGAGGAGGGTGCTCGTATGTTCATGGTGGTTAGA
GAGAGTTTTGAAGCTCTGAAAAATCCTGCGGTTCGATTTGCGTATGATAGGTAAGTGCAGTATACCAATTGCCGA
ATTATAGTATGAACTTACTTTGGTAGGTTTGGGCCTGACGTGTTGACCTGGAAAACCTGCAAGACGCAACGCGAT
TTTCTCTACCATGGTATTCTGCAGTCATCAGGTTATCATATTGTCACCTTTGCTGTACTTATCTTCTGGTCTACT
ATCGGAAAACACAGCCCAGCCTCCTTTGTACGTGTCACGTCATCAGAGCGCTACAGTTGACCTTACCTGTTCCTA
GTGGCGATTCCTCGTCTTTTCGTTCTTCCTCCTATCCGAGCTCACACTAGTCATTGCTCCCCCTGGGCACAAATC
TATCATATTCGGCCTATTTTCCAATCGCGTCATTTTTCAACACATCCTCTTCTTGCATCAACTTTTCCTGTTTTT
CAGCGTAGCTCTCAGCCGCGTTGCTCCGCTCTTCTCGTCCGGTGTAGATGATCCACGTTTGGAAAAGGCCGTGTT
GGAAAAAACACGAGCTTTGGCTAGCGTCGCTGACCGCGAAGGTAAATATCTCTTTTTTTTCATGGCTAGCCGAAA
AATAATTGACATGATTAGTCTCAATCATCCTGCACACGGACTTCCATTCTATATCTCCTTCTCCAGCTCCATCCA
ATGGTCGAGCAACGGTTCCTCTCATGACGCCCCTACCCAAAGAGGAAACCATATCACTCTTACAATCCCTCTTAC
CCAAAATGCAAGATCTCGTTATCGAGCATAACCTTAAAAAGGATTCCGGTCCACTTCGGAGTGCTTGGGAACAAG
CTATCTCACGGGGGAGGAGACTTCTTTTTTCTTCTGACCCGCAAAATGATCTGCAGAGCCAAGTGAAGAATTTCT
GGGAAGCGGAAAATGCAGATATCACTGGTTTTTCTACCGTCGATGGGAGTGCTTATTGTGTTGTGGATGGTCAGA
CTGAGGAAATGAATCTGGAGCCTTTGCCTTCTCCACCGCGTTCATTGTCGCCTAAACATTCAACAAACATGGAAA
AACGGCTGTCACAGGATATTTCGGTAGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail