Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049540
Gene name
Locationscaffold_2:2719771..2722071
Strand+
Gene length (bp)2300
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.2E-13 64 202
PF12146 Hydrolase_4 Serine aminopeptidase, S33 4.1E-08 80 183

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas sobria GN=pip PE=1 SV=3 13 452 5.0E-102

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049540
MATELYAGEQETYIIKEGVKVVERFFEVPLDYSNPTGEKIVVFARQEIPIQKAKTPEDQAKLPFVVYLQGGPGGE
VPLQRNSGFAAELFQEGYQVLWLDQRGTGLSTPLTPDTLPSHIKSDEQIAAYLKHFRQDNIVRDCEAIRKLLLGD
KENPEDRKWTLLGQSFGGFCAITYLSFFSEGIKEVFTCGGLAPLVEEPDAVYTAIVPRVIKRNKIYYEKYPRDVQ
RVRNIMNYLETNNVVLPNGGKLTPQRWQQLGFDFGMTGGIDRVHQLVFRASRELETIGKIGYKTLQSVEHSQAFD
GNPLFAIIHEAIYCQGRASRWSAERVVSQHTQFLWSHVKDLGANEPIYFTGEMMFSSMFDDYAHLRPWKRAAHLL
AQDSTWTPIYDLKQLSENKVKVTSATYYDDMYVDFNFAQDTAAKIKGTEQYITNQLFHDGVRAESKDVLKHLFAL
SKREYH*
Coding >AgabiH97|049540
ATGGCTACTGAACTTTATGCTGGAGAACAGGAAACATACATCATTAAAGAAGGAGTGAAAGTCGTCGAACGTTTC
TTTGAAGTCCCACTCGATTATTCTAATCCTACAGGAGAAAAGATTGTAGTATTCGCGAGACAAGAAATTCCGATT
CAAAAAGCGAAGACTCCTGAAGATCAAGCGAAACTTCCGTTCGTGGTATATCTGCAGGGAGGTCCCGGTGGTGAA
GTACCTTTACAAAGGAACTCTGGATTCGCAGCCGAGCTCTTTCAAGAAGGTTATCAGGTTCTCTGGCTCGATCAA
CGAGGGACAGGACTTAGCACTCCCCTAACTCCCGATACTCTTCCTTCCCACATCAAATCCGATGAACAAATCGCC
GCTTACCTCAAACATTTTCGACAAGATAACATCGTAAGGGACTGTGAAGCCATCCGAAAACTTCTTCTGGGTGAT
AAAGAAAACCCTGAAGATAGAAAATGGACACTTTTAGGACAAAGTTTCGGGGGATTTTGTGCCATCACGTATCTT
TCGTTCTTTAGCGAAGGGATTAAAGAAGTTTTTACATGTGGAGGTTTGGCACCTTTGGTAGAAGAGCCGGATGCC
GTTTATACTGCAATCGTTCCTCGTGTCATTAAACGGAACAAAATCTATTACGAGAAATATCCTCGGGATGTCCAA
AGGGTTCGGAACATTATGAACTATTTGGAGACCAATAACGTTGTACTTCCTAACGGTGGTAAACTTACCCCTCAG
AGATGGCAACAACTTGGATTCGACTTTGGAATGACTGGTGGGATCGATAGAGTACATCAACTCGTTTTTCGGGCT
TCAAGAGAACTCGAAACGATTGGAAAGATCGGGTACAAAACTCTACAATCGGTTGAACATTCACAAGCATTTGAT
GGTAATCCTCTATTCGCCATCATCCACGAAGCTATTTACTGCCAAGGTCGAGCTTCGCGTTGGTCGGCCGAGAGA
GTCGTATCTCAACATACTCAGTTCCTTTGGTCTCACGTCAAGGATCTAGGAGCAAATGAACCAATTTACTTTACA
GGAGAAATGATGTTTTCGAGCATGTTTGATGATTATGCACACTTGCGTCCATGGAAACGAGCTGCGCATTTATTG
GCGCAAGACTCCACCTGGACTCCTATTTACGATCTCAAACAATTGTCAGAGAATAAAGTCAAAGTGACTTCAGCT
ACCTATTATGATGACATGTATGTGGATTTCAATTTCGCACAAGATACGGCGGCGAAGATAAAGGGTACCGAACAA
TACATCACGAACCAATTATTCCATGATGGAGTTCGAGCGGAGTCAAAAGACGTTTTGAAACATCTTTTTGCACTC
TCAAAGCGGGAGTATCATTGA
Transcript >AgabiH97|049540
ATGGCTACTGAACTTTATGCTGGAGAACAGGAAACATACATCATTAAAGAAGGAGTGAAAGTCGTCGAACGTTTC
TTTGAAGTCCCACTCGATTATTCTAATCCTACAGGAGAAAAGATTGTAGTATTCGCGAGACAAGAAATTCCGATT
CAAAAAGCGAAGACTCCTGAAGATCAAGCGAAACTTCCGTTCGTGGTATATCTGCAGGGAGGTCCCGGTGGTGAA
GTACCTTTACAAAGGAACTCTGGATTCGCAGCCGAGCTCTTTCAAGAAGGTTATCAGGTTCTCTGGCTCGATCAA
CGAGGGACAGGACTTAGCACTCCCCTAACTCCCGATACTCTTCCTTCCCACATCAAATCCGATGAACAAATCGCC
GCTTACCTCAAACATTTTCGACAAGATAACATCGTAAGGGACTGTGAAGCCATCCGAAAACTTCTTCTGGGTGAT
AAAGAAAACCCTGAAGATAGAAAATGGACACTTTTAGGACAAAGTTTCGGGGGATTTTGTGCCATCACGTATCTT
TCGTTCTTTAGCGAAGGGATTAAAGAAGTTTTTACATGTGGAGGTTTGGCACCTTTGGTAGAAGAGCCGGATGCC
GTTTATACTGCAATCGTTCCTCGTGTCATTAAACGGAACAAAATCTATTACGAGAAATATCCTCGGGATGTCCAA
AGGGTTCGGAACATTATGAACTATTTGGAGACCAATAACGTTGTACTTCCTAACGGTGGTAAACTTACCCCTCAG
AGATGGCAACAACTTGGATTCGACTTTGGAATGACTGGTGGGATCGATAGAGTACATCAACTCGTTTTTCGGGCT
TCAAGAGAACTCGAAACGATTGGAAAGATCGGGTACAAAACTCTACAATCGGTTGAACATTCACAAGCATTTGAT
GGTAATCCTCTATTCGCCATCATCCACGAAGCTATTTACTGCCAAGGTCGAGCTTCGCGTTGGTCGGCCGAGAGA
GTCGTATCTCAACATACTCAGTTCCTTTGGTCTCACGTCAAGGATCTAGGAGCAAATGAACCAATTTACTTTACA
GGAGAAATGATGTTTTCGAGCATGTTTGATGATTATGCACACTTGCGTCCATGGAAACGAGCTGCGCATTTATTG
GCGCAAGACTCCACCTGGACTCCTATTTACGATCTCAAACAATTGTCAGAGAATAAAGTCAAAGTGACTTCAGCT
ACCTATTATGATGACATGTATGTGGATTTCAATTTCGCACAAGATACGGCGGCGAAGATAAAGGGTACCGAACAA
TACATCACGAACCAATTATTCCATGATGGAGTTCGAGCGGAGTCAAAAGACGTTTTGAAACATCTTTTTGCACTC
TCAAAGCGGGAGTATCATTGA
Gene >AgabiH97|049540
ATGGCTACTGAACTTTATGCTGGAGAACAGGAAACATACATCATTAAAGGTACGATTGATACCCACTAACCTACA
CTCCGATGTCATACTGATTGGTTACTTACCCTATTACAGAAGGAGTGAAAGTCGTCGAACGTTTCTTTGAAGTCC
CACTCGATTATTCTAATCCTACAGGAGAAAAGATTGTAGTATTCGCGAGACAAGAAATTCCGATTCAAAAAGCGA
AGACTCCTGAAGATCAAGCGAAACTTCCGTTCGGTAACTGTGATCCTTAACTTATCCTCTCCATTTGAAACTCAA
GCTTTCTTGATACGCAAGTGGTATATCTGCAGGGTAAGATTGTATACGTTTTTTATGAAGATGAGCATGTAGTGA
TGTAGGACGTAGGAGGTCCCGGTGGTGAAGTACCTTTACAAAGGAACTCTGGATTCGCAGCCGAGGTACCGTCAA
TTCGACTTGATTGAAACCATTGTTACATACCATTCACCTACCCCTAGCTCTTTCAAGAAGGTTATCAGGTAATTT
CCACAACAATATACTTACCACTTTGAGAGTAATCAGTCTTCGAAAAAACAAGGTTCTCTGGCTCGATCAACGAGG
GACAGGACTTAGCACTCCCCTAACTCCCGATACTCTTCCTTCCCACATCAAATCCGATGAACAAATCGCCGCTTA
CCTCAAACATTTTCGACAAGATAACATCGGTATGTCCATATATCAAACTTATTTCTTTCTTGTCATATCAATTAA
TCTGGCGGCGATACGAAATTTGCAGTAAGGGACTGTGAAGCCATCCGAAAACTTCTTCTGGGTGATAAAGAAAAC
CCTGAAGATAGAAAATGGACACTTTTAGGACAAAGTTTCGGGGGATTTTGTGCCATCACGTATCTTTCGTTCTTT
AGCGAAGGGATTAAAGAAGTTTTTACATGTGGAGGTTTGGCACCTTTGGTAGAAGAGCCGGATGCCGTTTATACT
GCAATCGTTCGTGAGTCGGCTGTCGAACCTTAAACATTTCTAAGTGGGGCTACAAAGTACTAATTTACCTTCGAT
GATTTGCAGCTCGTGTCATTAAACGGAACAAAATCTATTACGAGAAATATCCTCGGGATGTCCAAAGGGTATGTA
TATAGATATACGTCATTGCACGATAATCCAAACCAGTTCAATATTTTTTCCTTTTCTTTTTCTATATATCACAGG
TTCGGAACATTATGAACTATTTGGAGACCAATAACGTTGTACTTCCTAACGGTGGTAAACTTACCCCTCAGAGAT
GGCAACAACTTGGATTCGACTTTGGAATGACTGGTAAGCAAAATGATCCGCCTTTAATAAATAAAACTGATTTTT
TCTTTCGTTTCTTAGGTGGGATCGATAGAGTACATCGTTGAGTCGAATTGCACTAATGAACTACAAGTCAATGAC
TAACGATTTGTATCACCTTTCTTCTTTTTTAAAGAACTCGTTTTTCGGGCTTCAAGAGAACTCGAAACGATTGGA
AAGATCGGGTACAAAACTCTACAATCGGTTGAACATTCACAAGCATTTGATGGTAATCCTCTATTCGCCATCATC
CACGAAGCTATTTACTGCCAAGGGTAAGAATTTTCATAATAACAGAGCACCCCTAATTATAAAAGAAACCGGTTT
CCAATTTTTCTGTTTCCTCCTTCCTGTCCCCTATAGTCGAGCTTCGCGTTGGTCGGCCGAGAGAGTCGTATCTCA
ACATACTCAGTTCCTTTGGTCTCACGTCAAGGATCTAGGAGCAAATGAACCAATTTACTTTACAGGAGAAATGGT
GCGTGTACTCTTTATTTCCATCGTTGACGAATTTATATATATAATGAAGATGTTTTCGAGCATGTTTGATGATTA
TGCACACTTGCGTCCATGGAAACGAGCTGCGCATTTATTGGCGCAAGACTCCACCTGGACTCCTATTTACGATCT
CAAACAATTGTCAGAGAATAAAGTCAAAGTGACTTCAGCTACGTGGGTTTTACTTGGAGTTTTTGGAACATGGTT
CATGCTAATGTTGACCACCTTTATCAGCTATTATGATGACATGTCAGTTGACCTTCTCAACGAATCCGCGAAATA
ACGAACCACTGATTTCTTTTCTTTCTTTTTTACATATTTGTTTCAGGTATGTGGATTTCAATTTCGCACAAGATA
CGGCGGCGAAGATAAAGGGTACCGAACAATACATCACGAACCAATTATTCCATGATGGAGTTCGAGCGGAGTCAA
AAGACGTTTTGAAACATCTTTTTGCACTCTCAAAGCGGGAGTATCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail