Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049530
Gene name
Locationscaffold_2:2718494..2719464
Strand+
Gene length (bp)970
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04777 Evr1_Alr Erv1 / Alr family 4.5E-28 79 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 64 176 1.0E-38
sp|Q9Y806|ERV2_SCHPO FAD-linked sulfhydryl oxidase erv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv2 PE=3 SV=1 53 173 7.0E-27
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 74 180 1.0E-24
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 74 180 1.0E-24
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 74 180 6.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 64 176 1.0E-38
sp|Q9Y806|ERV2_SCHPO FAD-linked sulfhydryl oxidase erv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv2 PE=3 SV=1 53 173 7.0E-27
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 74 180 1.0E-24
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 74 180 1.0E-24
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 74 180 6.0E-23
sp|P27882|ERV1_YEAST Mitochondrial FAD-linked sulfhydryl oxidase ERV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV1 PE=1 SV=2 77 173 3.0E-20
sp|O14144|ERV1_SCHPO Mitochondrial FAD-linked sulfhydryl oxidase erv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv1 PE=3 SV=1 75 169 5.0E-20
sp|Q8GXX0|ERV1_ARATH FAD-linked sulfhydryl oxidase ERV1 OS=Arabidopsis thaliana GN=ERV1 PE=1 SV=1 74 170 6.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016972 thiol oxidase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049530
MISRFAKSLFIILFALVGLTMLAMLHPPSRAYLNPLTGQLFGEGGVEQTLNRPPKEGVVHGGVIMAKLGNETAKA
ALGRATWKLLHTVTLRFPENPTPDEREALDSYIRLTSRVYPCGECAAELQELLKVYPPQTSSRRAASLWLCSLHN
QVNERLNKPEYDCSQLSTEYDCGCGDDPLDSTSTKTTANPSKFDPMDLEIDTTKDEITGAGLIKGGR*
Coding >AgabiH97|049530
ATGATCTCCCGCTTCGCAAAGTCTCTCTTTATTATTCTATTCGCCCTGGTCGGGCTCACCATGCTGGCCATGTTG
CACCCGCCATCTCGCGCATACCTTAACCCTTTGACAGGCCAGCTTTTCGGCGAGGGTGGCGTCGAGCAAACCTTG
AATCGACCACCTAAGGAGGGGGTCGTACATGGCGGCGTGATAATGGCGAAACTAGGAAATGAAACTGCAAAAGCT
GCCCTTGGGAGGGCTACTTGGAAGTTGCTACATACAGTAACTCTCCGGTTTCCTGAAAACCCAACACCGGATGAA
CGCGAAGCACTCGACTCGTATATCCGTCTAACCTCACGGGTGTATCCATGCGGTGAATGCGCAGCTGAACTTCAG
GAACTACTGAAAGTTTATCCGCCACAAACGTCATCACGCCGCGCTGCTTCGCTATGGCTATGTAGCCTCCATAAT
CAAGTGAACGAGCGACTGAATAAACCAGAATACGACTGCTCCCAGCTATCTACCGAATACGACTGCGGCTGTGGA
GACGATCCACTTGACTCGACTTCAACAAAAACGACAGCAAATCCTTCAAAATTTGACCCCATGGATCTTGAAATT
GATACAACAAAGGACGAGATAACAGGGGCTGGACTCATCAAAGGTGGCCGATGA
Transcript >AgabiH97|049530
ATGATCTCCCGCTTCGCAAAGTCTCTCTTTATTATTCTATTCGCCCTGGTCGGGCTCACCATGCTGGCCATGTTG
CACCCGCCATCTCGCGCATACCTTAACCCTTTGACAGGCCAGCTTTTCGGCGAGGGTGGCGTCGAGCAAACCTTG
AATCGACCACCTAAGGAGGGGGTCGTACATGGCGGCGTGATAATGGCGAAACTAGGAAATGAAACTGCAAAAGCT
GCCCTTGGGAGGGCTACTTGGAAGTTGCTACATACAGTAACTCTCCGGTTTCCTGAAAACCCAACACCGGATGAA
CGCGAAGCACTCGACTCGTATATCCGTCTAACCTCACGGGTGTATCCATGCGGTGAATGCGCAGCTGAACTTCAG
GAACTACTGAAAGTTTATCCGCCACAAACGTCATCACGCCGCGCTGCTTCGCTATGGCTATGTAGCCTCCATAAT
CAAGTGAACGAGCGACTGAATAAACCAGAATACGACTGCTCCCAGCTATCTACCGAATACGACTGCGGCTGTGGA
GACGATCCACTTGACTCGACTTCAACAAAAACGACAGCAAATCCTTCAAAATTTGACCCCATGGATCTTGAAATT
GATACAACAAAGGACGAGATAACAGGGGCTGGACTCATCAAAGGTGGCCGATGA
Gene >AgabiH97|049530
ATGATCTCCCGCTTCGCAAAGTCTCTCTTTATTATTCTATTCGCCCTGGCAAGTCAAACATATGTTTAATGAGTT
TTTAATGACATTTCACATAGGTCGGGCTCACCATGCTGGCCATGTTGCACCCGCCATCTCGCGCATACCTTAACC
CTTTGACAGGCCAGCTTTTCGGCGAGGGTGGCGTCGAGCAAACCTTGAATCGACCACCTAAGGAGGGGGTCGTAC
ATGGCGGCGTGATAATGGCGAAACTAGGAAATGAAACTGCAAAGTAATGAGTCTTGCCTCAGAGGTCCACCACCT
TCGTCATTCTGATCTCGACAGAGCTGCCCTTGGGAGGGCTACTTGGAAGTTGCTGTATGTCTTTTTTACGTGGCG
CTACATAAGCTTGACTCGGTTCGCAGACATACAGTAACTCTCCGGTTTCCTGAAGTGCGTATCGCCGACAATTTT
TTAAATAATTAATCTAACACTCAGCTTTTGTAGAACCCAACACCGGATGAACGCGAAGCACTCGACTCGTATATC
CGTCTAACCTCACGGGTGTATCCATGCGGTGAATGCGCAGCTGAACTTCAGGAACTACTGAAAGTTTATCCGCCA
CAAGTACGTTCATTGCCTAAAACCATTTACCCTTTGTGTATTGACGCATTCTAATAGACGTCATCACGCCGCGCT
GCTTCGCTATGGTATGATTATCCTCGCTCCATTTCCCTTTCGATCATGACTAACCAATTACACTCCTTGAAGGCT
ATGTAGCCTCCATAATCAAGTGAACGAGCGACTGAATAAACCAGAATACGACTGCTCCCAGCTATCTACCGAATA
CGACTGCGGCTGTGGAGACGATCCACTTGACTCGACTTCAACAAAAACGACAGCAAATCCTTCAAAATTTGACCC
CATGGATCTTGAAATTGATACAACAAAGGACGAGATAACAGGGGCTGGACTCATCAAAGGTGGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail