Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049200
Gene name
Locationscaffold_2:2648637..2650395
Strand-
Gene length (bp)1758
Transcript length (bp)1158
Coding sequence length (bp)1158
Protein length (aa) 386

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03388 Lectin_leg-like Legume-like lectin family 4.6E-60 47 264

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94401|YQF8_SCHPO L-type lectin-like domain-containing protein C126.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.08c PE=3 SV=1 41 288 1.0E-43
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 48 334 2.0E-42
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 48 334 5.0E-42
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 48 334 1.0E-41
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 48 334 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94401|YQF8_SCHPO L-type lectin-like domain-containing protein C126.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.08c PE=3 SV=1 41 288 1.0E-43
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 48 334 2.0E-42
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 48 334 5.0E-42
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 48 334 1.0E-41
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 48 334 3.0E-41
sp|Q9DBH5|LMAN2_MOUSE Vesicular integral-membrane protein VIP36 OS=Mus musculus GN=Lman2 PE=1 SV=2 48 279 4.0E-37
sp|Q12907|LMAN2_HUMAN Vesicular integral-membrane protein VIP36 OS=Homo sapiens GN=LMAN2 PE=1 SV=1 48 280 4.0E-37
sp|P49256|LMAN2_CANLF Vesicular integral-membrane protein VIP36 OS=Canis lupus familiaris GN=LMAN2 PE=1 SV=1 48 280 7.0E-37
sp|Q9D0F3|LMAN1_MOUSE Protein ERGIC-53 OS=Mus musculus GN=Lman1 PE=1 SV=1 65 277 8.0E-19
sp|Q62902|LMAN1_RAT Protein ERGIC-53 OS=Rattus norvegicus GN=Lman1 PE=1 SV=1 65 277 2.0E-18
sp|P49257|LMAN1_HUMAN Protein ERGIC-53 OS=Homo sapiens GN=LMAN1 PE=1 SV=2 65 264 7.0E-18
sp|Q9TU32|LMAN1_CHLAE Protein ERGIC-53 OS=Chlorocebus aethiops GN=LMAN1 PE=2 SV=1 65 264 2.0E-17
sp|Q9HAT1|LMA1L_HUMAN Protein ERGIC-53-like OS=Homo sapiens GN=LMAN1L PE=2 SV=2 65 276 1.0E-10
sp|Q8VCD3|LMA1L_MOUSE Protein ERGIC-53-like OS=Mus musculus GN=Lman1l PE=2 SV=2 65 281 4.0E-10
sp|P36137|UIP5_YEAST Protein UIP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UIP5 PE=1 SV=1 51 266 4.0E-10
sp|Q5FB95|LMA1L_RAT Protein ERGIC-53-like OS=Rattus norvegicus GN=Lman1l PE=1 SV=1 65 266 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 303 325 22
2 338 360 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049200
MLPAVYSMFSISSLLVWSSLLLSGVQAGSGEVTTRIGNRTIERTLNLRTHSLYAPYIDQDLQNRWWDFGADAYIN
TNKHVRLTRNKPSLMGWLWSRLVLAPTNFVVEVEYKISGDSTHLFGDGLAMWITTERAQPGPVFGSKDNFNGLAV
VVDTYSNSRHSYSFPRISGFIFDGNQSYNVATDGDGQSVGGCSANIRRTNVATKIKVTYVKGSFLDVKVQYKAWD
DWSDCFYVEGVVLPNNLYLGFSAMTGDVSDAHDIISVTTSSAILSPDTSPKDKAKKGIFGSSKSGSSSSSLSGQD
SGSWFGLFFKLLLLAGVVGGGWYGWKEYQRRKRYGGFGAGNNFGGGGGIGGGGGGMGMGMGGGGSGTFGMGGGRY
RNPYANEKRF*
Coding >AgabiH97|049200
ATGCTACCAGCTGTTTATAGCATGTTTTCCATCTCCAGTCTCCTCGTATGGTCGTCGCTTCTACTCAGCGGAGTG
CAGGCGGGTAGTGGTGAAGTCACCACGCGGATTGGGAACCGCACAATTGAAAGAACTCTGAACCTCCGAACGCAT
TCGTTATACGCTCCTTACATTGATCAAGATCTTCAAAACAGGTGGTGGGACTTCGGCGCCGACGCCTACATCAAC
ACAAACAAACATGTCCGACTAACACGAAATAAACCCTCGTTAATGGGATGGTTATGGTCTCGCCTGGTGTTGGCA
CCAACGAATTTTGTTGTGGAAGTTGAATATAAGATCTCCGGGGACTCTACTCACCTATTCGGTGATGGACTCGCC
ATGTGGATCACGACTGAACGAGCCCAGCCAGGCCCCGTTTTCGGAAGCAAAGACAACTTTAATGGTCTTGCAGTC
GTTGTCGATACTTACTCTAATTCCCGGCATTCATACTCCTTCCCTCGCATCTCCGGTTTTATATTCGACGGAAAC
CAAAGCTACAACGTTGCCACTGATGGAGACGGTCAATCTGTTGGCGGGTGTTCTGCCAACATTCGTCGAACGAAT
GTCGCCACGAAAATCAAGGTGACATACGTCAAAGGTTCTTTCCTCGACGTGAAAGTGCAATACAAAGCCTGGGAT
GACTGGTCAGACTGTTTCTACGTCGAAGGCGTTGTACTGCCCAACAACCTATACCTCGGCTTTAGCGCCATGACA
GGCGATGTCTCCGACGCACACGATATCATATCTGTAACAACATCATCAGCCATCCTATCCCCCGACACCTCCCCA
AAAGACAAAGCCAAAAAGGGCATCTTCGGCAGCTCCAAATCCGGCTCATCTTCGTCATCTTTGTCAGGCCAAGAC
AGTGGAAGTTGGTTCGGCCTGTTTTTCAAACTTCTCTTGCTAGCCGGAGTCGTTGGTGGTGGTTGGTACGGATGG
AAAGAATATCAACGTAGAAAACGGTATGGAGGTTTCGGAGCCGGTAATAACTTCGGGGGAGGAGGCGGTATTGGA
GGAGGTGGTGGTGGTATGGGCATGGGCATGGGTGGTGGTGGTAGTGGTACGTTTGGTATGGGTGGTGGGAGATAT
CGAAATCCGTATGCGAACGAAAAACGGTTTTGA
Transcript >AgabiH97|049200
ATGCTACCAGCTGTTTATAGCATGTTTTCCATCTCCAGTCTCCTCGTATGGTCGTCGCTTCTACTCAGCGGAGTG
CAGGCGGGTAGTGGTGAAGTCACCACGCGGATTGGGAACCGCACAATTGAAAGAACTCTGAACCTCCGAACGCAT
TCGTTATACGCTCCTTACATTGATCAAGATCTTCAAAACAGGTGGTGGGACTTCGGCGCCGACGCCTACATCAAC
ACAAACAAACATGTCCGACTAACACGAAATAAACCCTCGTTAATGGGATGGTTATGGTCTCGCCTGGTGTTGGCA
CCAACGAATTTTGTTGTGGAAGTTGAATATAAGATCTCCGGGGACTCTACTCACCTATTCGGTGATGGACTCGCC
ATGTGGATCACGACTGAACGAGCCCAGCCAGGCCCCGTTTTCGGAAGCAAAGACAACTTTAATGGTCTTGCAGTC
GTTGTCGATACTTACTCTAATTCCCGGCATTCATACTCCTTCCCTCGCATCTCCGGTTTTATATTCGACGGAAAC
CAAAGCTACAACGTTGCCACTGATGGAGACGGTCAATCTGTTGGCGGGTGTTCTGCCAACATTCGTCGAACGAAT
GTCGCCACGAAAATCAAGGTGACATACGTCAAAGGTTCTTTCCTCGACGTGAAAGTGCAATACAAAGCCTGGGAT
GACTGGTCAGACTGTTTCTACGTCGAAGGCGTTGTACTGCCCAACAACCTATACCTCGGCTTTAGCGCCATGACA
GGCGATGTCTCCGACGCACACGATATCATATCTGTAACAACATCATCAGCCATCCTATCCCCCGACACCTCCCCA
AAAGACAAAGCCAAAAAGGGCATCTTCGGCAGCTCCAAATCCGGCTCATCTTCGTCATCTTTGTCAGGCCAAGAC
AGTGGAAGTTGGTTCGGCCTGTTTTTCAAACTTCTCTTGCTAGCCGGAGTCGTTGGTGGTGGTTGGTACGGATGG
AAAGAATATCAACGTAGAAAACGGTATGGAGGTTTCGGAGCCGGTAATAACTTCGGGGGAGGAGGCGGTATTGGA
GGAGGTGGTGGTGGTATGGGCATGGGCATGGGTGGTGGTGGTAGTGGTACGTTTGGTATGGGTGGTGGGAGATAT
CGAAATCCGTATGCGAACGAAAAACGGTTTTGA
Gene >AgabiH97|049200
ATGCTACCAGCTGTTTATAGCATGTTTTCCATCTCCAGTCTCCTCGTATGGTCGTCGCTTCTACTCAGCGGAGTG
CAGGCGGGTAGTGGTGAAGTCACCACGCGGATTGGGAACCGCACAATTGAAAGAGTATGTGTTTGTATTAGGGAA
TGATGAGAGGGTGGTTGTAGAACGCATCCTCATCATTGAACCCATGCCATAACCACACAAACTCATTCCGGTCAT
AGACTCTGAACCTCCGAACGCATTCGTTATACGCTCCTTACATTGATCAAGATCTTCAAAACAGGCATGTCGGCT
TTCCTGTTACTACGCTTCATGAATTAAATTGACCTTGTTGTACAGGTGGTGGGACTTCGGCGCCGACGCCTACAT
CGTATGTCAATGGTCTCGTCACAAGATACTGAAAGTAATGTTCATCTTTAGAACACAAACAAACATGTCCGACTA
ACACGAAATAAACCCTCGTTAATGGTATGACTTTTGGCATTTAATCATTCAGAGTTAATTGAGCACTTTCCATAG
GGATGGTTATGGTCTCGCCTGGTGTTGGCACCAACGAATTTTGTTGTGGAAGTTGAATATAAGGCAAGACCTACC
CAGTTGTGCCACTGCATGATGATATTGAGCAAACTTGTCATATAGATCTCCGGGGACTCTACTCACCTATTCGGT
GATGGACTCGCCATGTGGATCACGACTGAACGAGCCCAGCCAGGCCCCGTTTTCGGAAGCAAAGGTCCAGCTTCA
CTACCTATCTGCTTTCTTTTTTGCTCATTCTCCCTCTTTATAGACAACTTTAATGGTCTTGCAGTCGTTGTCGAT
ACGTACGCTCTTTGCCCGACACTCAGTTCCTTGATCTCAGTATAGGCTTCTAGTTACTCTAATTCCCGGCATTCA
TACTCCTTCCCTCGCATCTCCGGTTTTATATTCGACGGAAACCAAAGCTACAACGTTGCCACTGATGGAGACGGT
CAATCTGTTGGCGGGTGTTCTGTGAGCTTCTAATTCATCCACGAGCGGTACCACCCGTTCAACTTTCTAACAACT
CTCATAGGCCAACATTCGTCGAACGAATGTCGCCACGAAAATCAAGGTGACATACGTCAAAGGTTCTTTCCTCGA
CGTGAAAGTGCAATACAAAGCCTGTACGTCCAATTCTCTTCCCATAAATGGCCCCGACGATTTATGACCGGTTTT
TTAAAATTTAGGGGATGACTGGTCAGACTGTTTCTACGTCGAAGGCGTTGTACTGCCCAACAACCTATACCTCGG
CTTTAGCGCCATGACAGGCGATGTCTCCGACGCACACGAGTACGTTCCTCTCCCTCTCATATTCTCAAAAATAGC
ACATACTCACCTATCGTCATCAGTATCATATCTGTAACAACATCATCAGCCATCCTATCCCCCGACACCTCCCCA
AAAGACAAAGCCAAAAAGGGCATCTTCGGCAGCTCCAAATCCGGCTCATCTTCGTCATCTTTGTCAGGCCAAGAC
AGTGGAAGTTGGTTCGGCCTGTTTTTCAAACTTCTCTTGCTAGCCGGAGTCGTTGGTGGTGGTTGGTACGGATGG
AAAGAATATCAACGTAGAAAACGGTATGGAGGTTTCGGAGCCGGTAATAACTTCGGGGGAGGAGGCGGTATTGGA
GGAGGTGGTGGTGGTATGGGCATGGGCATGGGTGGTGGTGGTAGTGGTACGTTTGGTATGGGTGGTGGGAGATAT
CGAAATCCGTATGCGAACGAAAAACGGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail