Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049190
Gene name
Locationscaffold_2:2644289..2647571
Strand+
Gene length (bp)3282
Transcript length (bp)2760
Coding sequence length (bp)2760
Protein length (aa) 920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13513 HEAT_EZ HEAT-like repeat 9.7E-13 429 482

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=1 SV=2 4 919 0.0E+00
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 4 919 0.0E+00
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 2 919 0.0E+00
sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=1 SV=1 4 919 0.0E+00
sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=1 SV=3 4 919 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=1 SV=2 4 919 0.0E+00
sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 4 919 0.0E+00
sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 2 919 0.0E+00
sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=1 SV=1 4 919 0.0E+00
sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=1 SV=3 4 919 0.0E+00
sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 4 919 0.0E+00
sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 4 919 0.0E+00
sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 4 919 0.0E+00
sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1 SV=2 4 919 0.0E+00
sp|Q55CQ7|TNPO_DICDI Transportin OS=Dictyostelium discoideum GN=tnpo PE=3 SV=1 391 917 3.0E-118
sp|P38217|IMB2_YEAST Importin subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP104 PE=1 SV=1 2 861 4.0E-107
sp|Q8BIV3|RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus GN=Ranbp6 PE=1 SV=3 368 688 8.0E-17
sp|O60518|RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens GN=RANBP6 PE=1 SV=2 370 688 5.0E-15
sp|Q8BKC5|IPO5_MOUSE Importin-5 OS=Mus musculus GN=Ipo5 PE=1 SV=3 34 665 5.0E-14
sp|O00410|IPO5_HUMAN Importin-5 OS=Homo sapiens GN=IPO5 PE=1 SV=4 34 665 5.0E-13
sp|O13864|IMB1_SCHPO Importin subunit beta-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap95 PE=3 SV=1 377 580 9.0E-11
sp|Q9FJD4|IMB1_ARATH Importin subunit beta-1 OS=Arabidopsis thaliana GN=KPNB1 PE=1 SV=1 13 549 3.0E-10
sp|O74476|IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sal3 PE=3 SV=1 365 692 3.0E-09
sp|P32337|IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSE1 PE=1 SV=2 397 656 9.0E-08
sp|P52297|IMB_XENLA Importin subunit beta OS=Xenopus laevis GN=kpnb1 PE=1 SV=3 391 533 4.0E-07
sp|P70168|IMB1_MOUSE Importin subunit beta-1 OS=Mus musculus GN=Kpnb1 PE=1 SV=2 391 533 1.0E-06
sp|P52296|IMB1_RAT Importin subunit beta-1 OS=Rattus norvegicus GN=Kpnb1 PE=1 SV=1 391 533 1.0E-06
sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens GN=KPNB1 PE=1 SV=2 391 533 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049190
MSPWTPQPQGLEEILRTIHESTDMNITVQRSITQKLNSFTRIPEYIAYLAYILSAMTDQEDRIRTIAGYLLKNNS
RLILQAPAEVADYVKAAVLKAFNDSSIMIRNAASQDIVAFLGVLEPRNWPECLQQLVNALDASDLDKQEAAFNAL
EKACEDYPRKMDVEINGTRPLDYMIPKFLMLSEHNSAKMRSHAVACLSHFIPLNCQSLFIHIDNFIACLFKRASD
DDPSVRRHVCQALVLLLAARPEKLMPEMNNVAEYMLYSTKDKNENVALEACEFWLTFAEDADLAPYLHPLLGKVA
PVLLDCMVYGEDDLLWLEGDAEDAAVPDKESDIKPRHYGGKAHGLERESADPDQQQKPRIGAYGEETIDTDDEDD
YDDYDDDFAEEMSTEWNLRKCAAAALDVLAVRFSGDLLNVLLGPLKEKLWSEDWLQRESGILALGAMAEGCIEAI
EPHLPTLIPYLIQTLNEPKPLVRSITCWTLGRYASWCTQPISEEHKRNFFIPTMEGLLRMVLDNNKRVQEAGCSA
FATLEEDAGPELAPYLEPVLRNLVFAFEKYQHKNMLILYDAVGTLADAVGRALANPTYVEILMPPLTNRWAKLKD
NDEDLIPLLECLASVTIAMGQAFLNYAGPVFERCNNIIHQSLLAYQAFQQNPDLDEPGGSFLVVALDLLSGLTQG
LGMALEPFITNSTPNMLSLLTFCLKHPQAPVRQSAYALVGDMAMGCFVLLRPHMPGIMQELILQLDPEPKFEFIS
ASNNAAWSVGEVALRYGRDDAEFQQWVNPLIMRLIPILLHPKAPRSLHENAAVSIGRIGLMHPVLVAPRLPEFAQ
AWCQALYEIRDNDEKDSAFRGLCTLVQTNPAGIAKSLLWFCNSIVRWNQPSPELNNMFSTLLQGFKSHDEPGWAA
QMASFPPVIRDRLAARYGV*
Coding >AgabiH97|049190
ATGTCTCCGTGGACTCCCCAGCCCCAAGGCCTGGAGGAAATTTTGCGCACCATCCATGAGTCTACCGACATGAAC
ATCACCGTTCAGCGGTCCATCACACAGAAACTCAACTCCTTTACGCGTATCCCCGAGTATATCGCCTATCTGGCT
TATATTCTTAGTGCTATGACCGACCAGGAGGATCGCATACGCACCATCGCCGGCTATCTGCTAAAGAACAATTCT
CGCCTCATCTTGCAAGCCCCAGCTGAGGTTGCTGACTATGTCAAGGCTGCGGTGTTGAAGGCCTTCAATGATTCG
TCGATCATGATTCGTAACGCCGCGAGTCAGGATATTGTCGCTTTCCTAGGCGTCCTTGAGCCCAGAAACTGGCCA
GAATGCTTGCAGCAGCTGGTGAACGCGTTGGATGCCTCCGATTTGGATAAGCAAGAGGCTGCGTTCAATGCTCTA
GAAAAAGCTTGTGAAGATTATCCACGCAAAATGGACGTTGAGATCAATGGGACGAGGCCGCTTGACTACATGATT
CCCAAATTCCTCATGCTCTCTGAGCACAATTCAGCCAAAATGCGATCACACGCAGTCGCATGTCTTTCGCATTTC
ATCCCCCTCAATTGCCAATCTTTGTTTATCCATATCGACAACTTTATCGCTTGTCTGTTCAAGAGAGCGTCAGAT
GACGATCCCTCTGTGCGGCGTCACGTCTGCCAGGCCCTCGTTCTCCTCCTTGCAGCCCGTCCGGAAAAACTTATG
CCTGAAATGAACAATGTTGCGGAGTATATGCTCTATTCTACGAAGGACAAGAACGAAAACGTCGCATTGGAGGCT
TGCGAGTTTTGGCTTACATTTGCAGAGGATGCTGATCTCGCTCCATATCTACACCCGCTTTTGGGGAAGGTAGCC
CCAGTGCTGTTGGATTGCATGGTTTATGGAGAGGATGACTTGTTATGGTTAGAGGGTGACGCGGAGGATGCAGCC
GTTCCAGACAAAGAGTCTGATATCAAGCCGCGCCATTATGGAGGCAAAGCACATGGCCTGGAACGTGAAAGTGCA
GATCCCGATCAACAACAAAAACCTCGCATTGGTGCTTATGGCGAGGAGACCATTGATACTGACGACGAAGACGAT
TACGATGACTACGATGATGATTTCGCAGAGGAGATGTCGACGGAGTGGAACCTGCGAAAATGCGCTGCGGCAGCT
CTCGATGTTCTCGCAGTCAGATTTAGTGGCGATTTACTAAACGTTCTCCTCGGGCCGCTGAAAGAAAAACTTTGG
AGTGAAGATTGGCTGCAGAGAGAAAGTGGTATTCTAGCTTTGGGTGCCATGGCTGAAGGTTGCATTGAAGCCATC
GAGCCCCATCTACCGACGCTGATACCATACCTCATTCAAACACTCAATGAACCAAAACCCCTCGTGCGGTCAATT
ACTTGTTGGACCCTTGGGCGCTATGCGAGCTGGTGCACTCAGCCAATATCAGAAGAGCATAAGCGAAATTTCTTT
ATCCCCACTATGGAAGGTCTCCTTCGTATGGTTCTGGATAATAATAAACGCGTCCAAGAAGCCGGCTGTAGCGCT
TTTGCTACTCTCGAAGAGGATGCTGGACCAGAGCTCGCTCCTTACTTGGAGCCCGTTCTTCGGAATTTAGTATTT
GCTTTCGAGAAGTACCAGCACAAGAACATGTTGATCTTGTACGATGCCGTCGGTACTTTGGCTGACGCTGTTGGT
CGTGCGTTGGCAAACCCTACCTATGTGGAGATCTTGATGCCCCCATTGACCAATCGATGGGCAAAGCTAAAGGAT
AATGACGAAGACTTGATTCCTCTGTTGGAGTGCCTTGCTTCCGTGACCATTGCCATGGGCCAAGCATTTTTGAAT
TATGCAGGACCAGTCTTTGAGCGATGCAACAATATCATTCATCAATCCCTCCTTGCCTACCAGGCTTTCCAACAG
AATCCCGACCTTGACGAGCCTGGAGGCTCATTCTTGGTCGTTGCGCTCGACTTGCTTTCCGGCTTGACTCAAGGT
CTGGGAATGGCGTTGGAGCCCTTCATCACTAATAGCACACCAAACATGTTGAGTCTGTTGACCTTCTGTTTGAAA
CACCCGCAGGCCCCTGTCAGGCAATCAGCGTATGCATTGGTTGGTGATATGGCAATGGGATGTTTTGTATTGTTG
CGTCCCCACATGCCAGGCATTATGCAGGAGTTGATTCTGCAGCTTGATCCGGAACCTAAATTTGAGTTCATCAGT
GCTTCGAACAACGCCGCCTGGTCCGTTGGAGAAGTTGCTTTGCGTTACGGCCGAGATGACGCCGAGTTCCAGCAA
TGGGTGAATCCGCTGATTATGCGCCTCATTCCCATTCTTCTGCACCCCAAAGCACCTAGAAGTTTACATGAAAAT
GCCGCAGTTTCCATAGGTCGTATTGGGCTTATGCACCCCGTTCTTGTCGCACCTCGTCTACCTGAGTTTGCTCAG
GCTTGGTGTCAAGCTTTGTATGAAATTCGTGATAACGACGAGAAAGATTCTGCTTTCCGTGGGCTATGCACGCTG
GTACAAACCAATCCCGCCGGTATCGCCAAGAGTTTATTATGGTTTTGCAATTCGATCGTTCGCTGGAACCAGCCT
TCACCGGAACTTAACAATATGTTCAGCACGTTACTTCAAGGATTCAAGTCCCACGACGAGCCAGGATGGGCGGCC
CAGATGGCCTCATTCCCTCCTGTTATTCGGGACCGATTGGCTGCTCGGTATGGTGTTTAA
Transcript >AgabiH97|049190
ATGTCTCCGTGGACTCCCCAGCCCCAAGGCCTGGAGGAAATTTTGCGCACCATCCATGAGTCTACCGACATGAAC
ATCACCGTTCAGCGGTCCATCACACAGAAACTCAACTCCTTTACGCGTATCCCCGAGTATATCGCCTATCTGGCT
TATATTCTTAGTGCTATGACCGACCAGGAGGATCGCATACGCACCATCGCCGGCTATCTGCTAAAGAACAATTCT
CGCCTCATCTTGCAAGCCCCAGCTGAGGTTGCTGACTATGTCAAGGCTGCGGTGTTGAAGGCCTTCAATGATTCG
TCGATCATGATTCGTAACGCCGCGAGTCAGGATATTGTCGCTTTCCTAGGCGTCCTTGAGCCCAGAAACTGGCCA
GAATGCTTGCAGCAGCTGGTGAACGCGTTGGATGCCTCCGATTTGGATAAGCAAGAGGCTGCGTTCAATGCTCTA
GAAAAAGCTTGTGAAGATTATCCACGCAAAATGGACGTTGAGATCAATGGGACGAGGCCGCTTGACTACATGATT
CCCAAATTCCTCATGCTCTCTGAGCACAATTCAGCCAAAATGCGATCACACGCAGTCGCATGTCTTTCGCATTTC
ATCCCCCTCAATTGCCAATCTTTGTTTATCCATATCGACAACTTTATCGCTTGTCTGTTCAAGAGAGCGTCAGAT
GACGATCCCTCTGTGCGGCGTCACGTCTGCCAGGCCCTCGTTCTCCTCCTTGCAGCCCGTCCGGAAAAACTTATG
CCTGAAATGAACAATGTTGCGGAGTATATGCTCTATTCTACGAAGGACAAGAACGAAAACGTCGCATTGGAGGCT
TGCGAGTTTTGGCTTACATTTGCAGAGGATGCTGATCTCGCTCCATATCTACACCCGCTTTTGGGGAAGGTAGCC
CCAGTGCTGTTGGATTGCATGGTTTATGGAGAGGATGACTTGTTATGGTTAGAGGGTGACGCGGAGGATGCAGCC
GTTCCAGACAAAGAGTCTGATATCAAGCCGCGCCATTATGGAGGCAAAGCACATGGCCTGGAACGTGAAAGTGCA
GATCCCGATCAACAACAAAAACCTCGCATTGGTGCTTATGGCGAGGAGACCATTGATACTGACGACGAAGACGAT
TACGATGACTACGATGATGATTTCGCAGAGGAGATGTCGACGGAGTGGAACCTGCGAAAATGCGCTGCGGCAGCT
CTCGATGTTCTCGCAGTCAGATTTAGTGGCGATTTACTAAACGTTCTCCTCGGGCCGCTGAAAGAAAAACTTTGG
AGTGAAGATTGGCTGCAGAGAGAAAGTGGTATTCTAGCTTTGGGTGCCATGGCTGAAGGTTGCATTGAAGCCATC
GAGCCCCATCTACCGACGCTGATACCATACCTCATTCAAACACTCAATGAACCAAAACCCCTCGTGCGGTCAATT
ACTTGTTGGACCCTTGGGCGCTATGCGAGCTGGTGCACTCAGCCAATATCAGAAGAGCATAAGCGAAATTTCTTT
ATCCCCACTATGGAAGGTCTCCTTCGTATGGTTCTGGATAATAATAAACGCGTCCAAGAAGCCGGCTGTAGCGCT
TTTGCTACTCTCGAAGAGGATGCTGGACCAGAGCTCGCTCCTTACTTGGAGCCCGTTCTTCGGAATTTAGTATTT
GCTTTCGAGAAGTACCAGCACAAGAACATGTTGATCTTGTACGATGCCGTCGGTACTTTGGCTGACGCTGTTGGT
CGTGCGTTGGCAAACCCTACCTATGTGGAGATCTTGATGCCCCCATTGACCAATCGATGGGCAAAGCTAAAGGAT
AATGACGAAGACTTGATTCCTCTGTTGGAGTGCCTTGCTTCCGTGACCATTGCCATGGGCCAAGCATTTTTGAAT
TATGCAGGACCAGTCTTTGAGCGATGCAACAATATCATTCATCAATCCCTCCTTGCCTACCAGGCTTTCCAACAG
AATCCCGACCTTGACGAGCCTGGAGGCTCATTCTTGGTCGTTGCGCTCGACTTGCTTTCCGGCTTGACTCAAGGT
CTGGGAATGGCGTTGGAGCCCTTCATCACTAATAGCACACCAAACATGTTGAGTCTGTTGACCTTCTGTTTGAAA
CACCCGCAGGCCCCTGTCAGGCAATCAGCGTATGCATTGGTTGGTGATATGGCAATGGGATGTTTTGTATTGTTG
CGTCCCCACATGCCAGGCATTATGCAGGAGTTGATTCTGCAGCTTGATCCGGAACCTAAATTTGAGTTCATCAGT
GCTTCGAACAACGCCGCCTGGTCCGTTGGAGAAGTTGCTTTGCGTTACGGCCGAGATGACGCCGAGTTCCAGCAA
TGGGTGAATCCGCTGATTATGCGCCTCATTCCCATTCTTCTGCACCCCAAAGCACCTAGAAGTTTACATGAAAAT
GCCGCAGTTTCCATAGGTCGTATTGGGCTTATGCACCCCGTTCTTGTCGCACCTCGTCTACCTGAGTTTGCTCAG
GCTTGGTGTCAAGCTTTGTATGAAATTCGTGATAACGACGAGAAAGATTCTGCTTTCCGTGGGCTATGCACGCTG
GTACAAACCAATCCCGCCGGTATCGCCAAGAGTTTATTATGGTTTTGCAATTCGATCGTTCGCTGGAACCAGCCT
TCACCGGAACTTAACAATATGTTCAGCACGTTACTTCAAGGATTCAAGTCCCACGACGAGCCAGGATGGGCGGCC
CAGATGGCCTCATTCCCTCCTGTTATTCGGGACCGATTGGCTGCTCGGTATGGTGTTTAA
Gene >AgabiH97|049190
ATGTCTCCGTGGACTCCCCAGCCCCAAGGCCTGGAGGAAATTTTGCGCACCATCCATGAGTCTACCGACATGAAC
ATCACCGTTCAGCGGTCCATCACACAGGCAAGTCTCTCTCCCTGCTTTCGCTCTTTAGCCCTCAGGAGCCTCATC
TTTGTGTGCATCGGAACCACAGAAACTCAACTCCTTTACGCGTATCCCCGAGTATATCGCCTATCTGGCTTATAT
TCTTAGTGCTATGACCGACCAGGAGGATCGCATACGCACCATCGCCGGCTATCTGCTAAAGAACAATTCTCGCCT
CATCTTGCAAGCCCCAGCTGAGGTTGCTGACTATGTCAAGGCTGCGGTGTTGAAGGCCTTCAATGATTCGTCGAT
CATGATTCGTAACGCCGCGAGTCAGGATATTGTCGCTTTCCTAGGCGTCCTTGAGCCCAGAAACTGGCCAGAATG
CTTGCAGCAGCTGGTGAACGCGTTGGATGCCTCCGATTTGGATAAGCAAGAGGTGAGCGACCCTTGAACACGTAA
TGTCCTCGGGCCCGACCTACCCCATGCTGCCCAACCCCGTTGGCCTTGGGGGTCGCCGCGTCATCCCGGCAGGGA
ACATTAGCGTTATCATGTTTACTAAACGCCCTTCCAGGCTGCGTTCAATGCTCTAGAAAAAGCTTGTGAAGATTA
TCCACGCAAAATGGACGTTGAGATCAATGGGACGAGGCCGCTTGACTACATGATTCCCAAATTCCTCATGCTCTC
TGAGCACAATTCAGCCAAAATGCGATCACACGCAGTCGCATGTCTTTCGCATTTCATCCCCCTCAATTGCCAATC
TTTGTTTATCCATATCGACAACTTTATCGCTTGTCTGTTCAAGAGAGCGTCAGATGACGATCCCTCTGTGCGGCG
TCACGTCTGCCAGGCCCTCGTTCTCCTCCTTGCAGCCCGTCCGGAAAAACTTATGCCTGAAATGAACAATGTTGC
GGAGTATATGCTCTATTCTACGAAGGACAAGAACGAAAACGTCGCATTGGAGGCTTGCGAGTTTTGGCTTACATT
TGCAGAGGATGCTGATCTCGCTCCATATCTACACCCGCTTTTGGGGAAGGTAGCCCCAGTGCTGTTGGATTGCAT
GGTTTATGGAGAGGATGACTTGTTATGGTTAGAGGGTGACGCGGAGGATGCAGCCGTTCCAGACAAAGAGTCTGA
TATCAAGCCGCGCCATTATGGAGGCAAAGCACATGGCCTGGAACGTGAAAGTGCAGATCCCGATCAACAACAAAA
ACCTCGCATTGGTGCTTATGGCGAGGAGACCATTGATACTGACGACGAAGACGATTACGATGACTACGATGATGA
TTTCGCAGAGGAGATGTCGACGGAGTGGAACCTGCGAAAATGCGCTGCGGCAGCTCTCGATGTTCTCGCAGTCAG
ATTTAGTGGCGATTTACTAAACGTTCTCCTCGGGCCGCTGAAAGAAAAACTTTGGAGTGAAGATTGGCTGCAGAG
AGAAAGTGGTATTCTAGCTTTGGGTGCCATGGCTGAAGGTATGTGGATTCTGTCCTGGTCTCTGTTCCCTTTAAT
CACGCATTAGTAGGTTGCATTGAAGCCATCGAGCCCCATCTACCGACGCTGATACCATACCTCATTCAAACACTC
AATGAACCAAAAGTATGTGATGTGTCATTAACCCATCTCAGTCCTCTCTCTGACCGTTTTCGAAGCCCCTCGTGC
GGTCAATTACTTGTTGGACCCTTGGGCGCTATGCGAGCTGGTGCACTCAGCCAATATCAGAAGAGCATAAGCGAA
ATTTCTTTATCCCCACTATGGAAGGTGTACGTTATGGTTGCAACTTAAGGTTGACTGTGGCTGATTCGCACTTCT
AGCTCCTTCGTATGGTTCTGGATAATAATAAACGCGTCCAAGAAGCCGGCTGTAGCGCTTTTGCTACTCTCGAAG
AGGATGCTGGACCAGAGCTCGCTCCTTACTTGGAGCCCGTTCTTCGGAATTTAGTATTTGCTTTCGAGAAGTACC
AGCACAAGAACATGTTGATCTTGTACGATGCCGTCGGTACTTTGGCTGACGCTGTTGGTCGTGCGTTGGCAAACC
CTACCTATGTGGAGATCTTGATGCCCCCATTGACCAATCGATGGGCAAAGCTAAAGGATAATGACGAAGACTTGA
TTCCTCTGTTGGAGGTGCGTATTTCCTTGCCTTGTTGATGGGAACCATCTGAGTGCGTGCGGTGTTAGTGCCTTG
CTTCCGTGACCATTGCCATGGGCCAAGCATTTTTGAATTATGCAGGACCAGTCTTTGAGCGATGCAACAATATCA
TTCATCAATCCCTCCTTGCCTACCAGGCTTTCCAACAGAATCCCGACCTTGACGAGCCTGGAGGCTCATTCTTGG
TCGTTGCGCTCGACTTGCTTTCCGGCTTGACTCAAGGTCTGGGAATGGCGTTGGAGCCCTTCATCACTAATAGCA
CACCAAACATGTTGAGTCTGTTGACCTTCTGTTTGAAACACCCGCAGGCCCCTGTCAGGCAATCAGCGTATGCAT
TGGTTGGTGATATGGCAATGGGATGTTTTGTATTGTTGCGTCCCCACATGCCAGGCATTATGCAGGAGTTGATTC
TGCAGCTTGATCCGGAACCTAAATTTGAGTTCATCAGTGCTTCGAACAACGCCGCCTGGTCCGTTGGAGAAGTTG
CTTTGCGTTACGGCCGAGGTGAGCGTTACTTTTGTATTGTAGGTGAGGACCTGATGCTGACCTCTGTTCGTTGAA
GATGACGCCGAGTTCCAGCAATGGGTGAATCCGCTGATTATGCGCCTCATTCCCATTCTTCTGCACCCCAAAGCA
CCTAGAAGTTTACATGAAAATGCCGCAGTTTCCATAGGTCGTATTGGGCTTATGCACCCCGTTCTTGTCGCACCT
CGTCTACCTGAGTTTGCTCAGGCTTGGTGTCAAGCTTTGTATGAAATTCGTGATAACGACGAGAAAGATTCTGCT
TTCCGTGGGCTATGCACGCTGGTACAAACCAATCCCGCCGGTATCGCCAAGGTACGCGCTTGCCTAGTTTAATCG
AATAATACTGACGTAGTCGTGTTCCAGAGTTTATTATGGTTTTGCAATTCGATCGTTCGCTGGAACCAGCCTTCA
CCGGAACTTAACAATATGTTCAGCACGTTACTTCAAGGATTCAAGTCCCACGACGAGCCAGGATGGGCGGCCCAG
ATGGCCTCATTCCCTCCTGTTATTCGGGACCGATTGGCTGCTCGGTATGGTGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail