Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|049030
Gene name
Locationscaffold_2:2607834..2610543
Strand+
Gene length (bp)2709
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 1.0E-37 95 233
PF00916 Sulfate_transp Sulfate permease family 4.1E-33 246 430
PF01740 STAS STAS domain 3.1E-16 498 615

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53394|SULX_YEAST Putative sulfate transporter YPR003C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR003C PE=1 SV=1 67 599 2.0E-93
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.05 PE=3 SV=1 35 621 2.0E-74
sp|Q8GYH8|SUT42_ARATH Probable sulfate transporter 4.2 OS=Arabidopsis thaliana GN=SULTR4;2 PE=2 SV=2 73 618 1.0E-61
sp|Q9FY46|SUT41_ARATH Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana GN=SULTR4;1 PE=1 SV=1 80 623 7.0E-59
sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3 OS=Arabidopsis thaliana GN=SULTR3;3 PE=2 SV=2 76 607 6.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53394|SULX_YEAST Putative sulfate transporter YPR003C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR003C PE=1 SV=1 67 599 2.0E-93
sp|O59782|SULH3_SCHPO Probable sulfate permease C320.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.05 PE=3 SV=1 35 621 2.0E-74
sp|Q8GYH8|SUT42_ARATH Probable sulfate transporter 4.2 OS=Arabidopsis thaliana GN=SULTR4;2 PE=2 SV=2 73 618 1.0E-61
sp|Q9FY46|SUT41_ARATH Sulfate transporter 4.1, chloroplastic OS=Arabidopsis thaliana GN=SULTR4;1 PE=1 SV=1 80 623 7.0E-59
sp|Q9SXS2|SUT33_ARATH Probable sulfate transporter 3.3 OS=Arabidopsis thaliana GN=SULTR3;3 PE=2 SV=2 76 607 6.0E-54
sp|Q9SV13|SUT31_ARATH Sulfate transporter 3.1 OS=Arabidopsis thaliana GN=SULTR3;1 PE=2 SV=1 75 616 3.0E-50
sp|A8J6J0|SULT2_CHLRE Proton/sulfate cotransporter 2 OS=Chlamydomonas reinhardtii GN=SULTR2 PE=2 SV=1 75 617 1.0E-49
sp|P53392|SUT2_STYHA High affinity sulfate transporter 2 OS=Stylosanthes hamata GN=ST2 PE=2 SV=1 75 617 2.0E-46
sp|Q9EPH0|S26A5_RAT Prestin OS=Rattus norvegicus GN=Slc26a5 PE=1 SV=1 35 526 6.0E-46
sp|P58743|S26A5_HUMAN Prestin OS=Homo sapiens GN=SLC26A5 PE=2 SV=1 35 526 1.0E-45
sp|P53391|SUT1_STYHA High affinity sulfate transporter 1 OS=Stylosanthes hamata GN=ST1 PE=2 SV=1 58 617 1.0E-45
sp|Q99NH7|S26A5_MOUSE Prestin OS=Mus musculus GN=Slc26a5 PE=2 SV=3 68 526 5.0E-45
sp|Q9JKQ2|S26A5_MERUN Prestin OS=Meriones unguiculatus GN=SLC26A5 PE=1 SV=1 68 526 5.0E-45
sp|Q8CIW6|S26A6_MOUSE Solute carrier family 26 member 6 OS=Mus musculus GN=Slc26a6 PE=1 SV=2 78 526 3.0E-44
sp|Q9FEP7|SUT13_ARATH Sulfate transporter 1.3 OS=Arabidopsis thaliana GN=SULTR1;3 PE=2 SV=1 80 616 8.0E-44
sp|Q9LW86|SUT34_ARATH Probable sulfate transporter 3.4 OS=Arabidopsis thaliana GN=SULTR3;4 PE=2 SV=1 75 617 3.0E-43
sp|O04722|SUT21_ARATH Sulfate transporter 2.1 OS=Arabidopsis thaliana GN=SULTR2;1 PE=2 SV=1 68 616 7.0E-43
sp|Q9BXS9|S26A6_HUMAN Solute carrier family 26 member 6 OS=Homo sapiens GN=SLC26A6 PE=1 SV=1 75 526 2.0E-42
sp|P53393|SUT3_STYHA Low affinity sulfate transporter 3 OS=Stylosanthes hamata GN=ST3 PE=2 SV=1 80 616 3.0E-42
sp|P9WGF6|Y1739_MYCTO Probable sulfate transporter MT1781 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1781 PE=3 SV=1 78 617 4.0E-42
sp|P9WGF7|Y1739_MYCTU Probable sulfate transporter Rv1739c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1739c PE=1 SV=1 78 617 3.0E-41
sp|P92946|SUT22_ARATH Sulfate transporter 2.2 OS=Arabidopsis thaliana GN=SULTR2;2 PE=1 SV=3 75 618 5.0E-41
sp|Q9MAX3|SUT12_ARATH Sulfate transporter 1.2 OS=Arabidopsis thaliana GN=SULTR1;2 PE=1 SV=1 75 617 2.0E-39
sp|Q9SAY1|SUT11_ARATH Sulfate transporter 1.1 OS=Arabidopsis thaliana GN=SULTR1;1 PE=1 SV=2 80 618 5.0E-38
sp|O04289|SUT32_ARATH Sulfate transporter 3.2 OS=Arabidopsis thaliana GN=SULTR3;2 PE=2 SV=1 63 617 1.0E-37
sp|O70531|S26A2_RAT Sulfate transporter OS=Rattus norvegicus GN=Slc26a2 PE=2 SV=1 71 479 1.0E-36
sp|Q62273|S26A2_MOUSE Sulfate transporter OS=Mus musculus GN=Slc26a2 PE=1 SV=1 78 585 4.0E-36
sp|Q65AC2|S26A2_HORSE Sulfate transporter OS=Equus caballus GN=SLC26A2 PE=2 SV=1 78 529 2.0E-34
sp|P50443|S26A2_HUMAN Sulfate transporter OS=Homo sapiens GN=SLC26A2 PE=1 SV=2 63 526 3.0E-34
sp|Q9URY8|SULH2_SCHPO Probable sulfate permease C869.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC869.05c PE=1 SV=1 75 588 1.0E-33
sp|O74377|SULH1_SCHPO Probable sulfate permease C3H7.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.02 PE=3 SV=1 69 598 1.0E-31
sp|P45380|S26A1_RAT Sulfate anion transporter 1 OS=Rattus norvegicus GN=Slc26a1 PE=1 SV=1 80 516 1.0E-31
sp|P58735|S26A1_MOUSE Sulfate anion transporter 1 OS=Mus musculus GN=Slc26a1 PE=1 SV=1 80 527 5.0E-31
sp|P40879|S26A3_HUMAN Chloride anion exchanger OS=Homo sapiens GN=SLC26A3 PE=1 SV=1 80 534 4.0E-30
sp|Q924C9|S26A3_RAT Chloride anion exchanger OS=Rattus norvegicus GN=Slc26a3 PE=2 SV=1 80 534 5.0E-29
sp|Q69DJ1|S26A2_BUBBU Sulfate transporter OS=Bubalus bubalis GN=SLC26A2 PE=3 SV=1 78 529 6.0E-29
sp|Q9WVC8|S26A3_MOUSE Chloride anion exchanger OS=Mus musculus GN=Slc26a3 PE=1 SV=1 80 534 8.0E-29
sp|Q9H2B4|S26A1_HUMAN Sulfate anion transporter 1 OS=Homo sapiens GN=SLC26A1 PE=1 SV=2 69 624 1.0E-28
sp|Q8BU91|S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus musculus GN=Slc26a9 PE=2 SV=1 79 524 1.0E-28
sp|Q96RN1|S26A8_HUMAN Testis anion transporter 1 OS=Homo sapiens GN=SLC26A8 PE=1 SV=1 80 557 1.0E-28
sp|Q7LBE3|S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo sapiens GN=SLC26A9 PE=1 SV=1 79 524 2.0E-28
sp|Q8R0C3|S26A8_MOUSE Testis anion transporter 1 OS=Mus musculus GN=Slc26a8 PE=2 SV=2 80 579 6.0E-28
sp|Q02920|NO70_SOYBN Early nodulin-70 OS=Glycine max PE=2 SV=1 34 409 1.0E-27
sp|Q8R2Z3|S26A7_MOUSE Anion exchange transporter OS=Mus musculus GN=Slc26a7 PE=2 SV=3 76 624 4.0E-27
sp|O43511|S26A4_HUMAN Pendrin OS=Homo sapiens GN=SLC26A4 PE=1 SV=1 75 536 2.0E-25
sp|Q94LW6|SUT35_ARATH Probable sulfate transporter 3.5 OS=Arabidopsis thaliana GN=SULTR3;5 PE=2 SV=1 72 233 6.0E-24
sp|A4IIF2|S26A9_XENTR Solute carrier family 26 member 9 OS=Xenopus tropicalis GN=slc26a9 PE=2 SV=1 69 539 8.0E-24
sp|Q9R154|S26A4_RAT Pendrin OS=Rattus norvegicus GN=Slc26a4 PE=2 SV=1 75 536 5.0E-22
sp|Q9R155|S26A4_MOUSE Pendrin OS=Mus musculus GN=Slc26a4 PE=1 SV=1 75 522 7.0E-21
sp|Q12325|SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL2 PE=1 SV=1 12 238 1.0E-20
sp|Q4R445|S26A8_MACFA Testis anion transporter 1 OS=Macaca fascicularis GN=SLC26A8 PE=2 SV=1 322 555 1.0E-20
sp|P38359|SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL1 PE=1 SV=2 37 238 4.0E-20
sp|Q9BEG8|S26A2_BOVIN Sulfate transporter OS=Bos taurus GN=SLC26A2 PE=3 SV=1 78 229 7.0E-20
sp|Q9GJY3|S26A2_SHEEP Sulfate transporter OS=Ovis aries GN=SLC26A2 PE=3 SV=1 78 229 6.0E-19
sp|Q8TE54|S26A7_HUMAN Anion exchange transporter OS=Homo sapiens GN=SLC26A7 PE=2 SV=2 79 585 7.0E-19
sp|A6QNW6|S26A8_BOVIN Testis anion transporter 1 OS=Bos taurus GN=SLC26A8 PE=2 SV=1 322 529 3.0E-17
sp|O06984|YVDB_BACSU Putative sulfate transporter YvdB OS=Bacillus subtilis (strain 168) GN=yvdB PE=3 SV=1 88 608 5.0E-17
sp|Q5EBI0|S2610_MOUSE Solute carrier family 26 member 10 OS=Mus musculus GN=Slc26a10 PE=2 SV=1 79 408 7.0E-17
sp|Q5RAL2|S26A7_PONAB Anion exchange transporter OS=Pongo abelii GN=SLC26A7 PE=2 SV=1 305 585 1.0E-16
sp|Q86WA9|S2611_HUMAN Sodium-independent sulfate anion transporter OS=Homo sapiens GN=SLC26A11 PE=2 SV=2 67 229 4.0E-15
sp|Q86WA9|S2611_HUMAN Sodium-independent sulfate anion transporter OS=Homo sapiens GN=SLC26A11 PE=2 SV=2 309 608 5.0E-15
sp|Q58DD2|S2611_BOVIN Sodium-independent sulfate anion transporter OS=Bos taurus GN=SLC26A11 PE=2 SV=1 309 608 2.0E-14
sp|P23622|CYS14_NEUCR Sulfate permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-14 PE=2 SV=3 32 229 3.0E-14
sp|Q80ZD3|S2611_MOUSE Sodium-independent sulfate anion transporter OS=Mus musculus GN=Slc26a11 PE=2 SV=2 309 608 1.0E-13
sp|Q58DD2|S2611_BOVIN Sodium-independent sulfate anion transporter OS=Bos taurus GN=SLC26A11 PE=2 SV=1 72 229 1.0E-13
sp|Q80ZD3|S2611_MOUSE Sodium-independent sulfate anion transporter OS=Mus musculus GN=Slc26a11 PE=2 SV=2 75 229 1.0E-13
sp|P55189|YBAR_BACSU Putative sulfate transporter YbaR OS=Bacillus subtilis (strain 168) GN=ybaR PE=3 SV=2 96 412 3.0E-12
sp|Q12325|SUL2_YEAST Sulfate permease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL2 PE=1 SV=1 312 482 2.0E-11
sp|Q94LW6|SUT35_ARATH Probable sulfate transporter 3.5 OS=Arabidopsis thaliana GN=SULTR3;5 PE=2 SV=1 298 617 1.0E-10
sp|Q94225|SULP3_CAEEL Sulfate permease family protein 3 OS=Caenorhabditis elegans GN=sulp-3 PE=2 SV=3 322 520 2.0E-10
sp|P38359|SUL1_YEAST Sulfate permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUL1 PE=1 SV=2 312 602 2.0E-10
sp|P23622|CYS14_NEUCR Sulfate permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-14 PE=2 SV=3 331 609 4.0E-10
sp|Q94225|SULP3_CAEEL Sulfate permease family protein 3 OS=Caenorhabditis elegans GN=sulp-3 PE=2 SV=3 68 232 3.0E-09
sp|Q9GJY3|S26A2_SHEEP Sulfate transporter OS=Ovis aries GN=SLC26A2 PE=3 SV=1 326 529 1.0E-07
sp|Q9BEG8|S26A2_BOVIN Sulfate transporter OS=Bos taurus GN=SLC26A2 PE=3 SV=1 326 529 1.0E-07
sp|Q8NG04|S2610_HUMAN Solute carrier family 26 member 10 OS=Homo sapiens GN=SLC26A10 PE=2 SV=1 310 408 2.0E-07
sp|Q5RAL2|S26A7_PONAB Anion exchange transporter OS=Pongo abelii GN=SLC26A7 PE=2 SV=1 79 229 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015698 inorganic anion transport No
GO:0072348 sulfur compound transport No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008509 anion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 118 140 22
2 177 199 22
3 211 233 22
4 299 321 22
5 340 362 22
6 377 399 22
7 404 426 22
8 436 467 31

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|049030
MASTPPHRSFSSAHSLANSTSSLMGIDAEATVPAEERTALLDRAADQRTEYTSGAATPSTFYNAGKDPSVLSKRL
KYYIPSLAWIPKYSVSLIGGDVLAGLTVASVLIPQSVSYATSLAKISPVTGLISASVPGIIYAFLGTSRQLNVAP
EAATSLLVGQAVADILHDHTGDDVATLGLIISTAITLQAGLIEFLLGFFRLGFIDVVLSRALLRGFITAVAVVIM
VEQLIPMFDHLSMSICLVKLPPAIDRLLLVVIASTVLSAHYQWDEDGLDILGSVKVTTGSSFFVSPFTTKTLKYA
HSTTSTAFIISIVGFLDSIVAAKQNAAHFGYSISPNRELVALGAANVGASFIPGTLPAFGSITRSRINGDVGGRT
QMASLVCSAVVLLATFVFLPWMYYLPKCVLAVVITLIIFSLLAETPHDVVYYWRMGAWIDLGLMFLTFVCSIVYN
VEVGIVVSLIISLLLLVHRSSKTRMTILGRVHGTDRWRPVNEDPEAEEDVPGVLVIRIRENLDFANTAQLKERLR
RLELYGPIKTHPSEAPMRQETTVIVFHMADVDKCDASAMQIFYELLEEYKVRGVDLFITHLKNKPQRQFMQAGIW
DLLGADAFRQTVADAISIVEASNQ*
Coding >AgabiH97|049030
ATGGCGTCCACTCCCCCCCACCGCAGCTTCTCCTCTGCCCACAGCCTCGCAAACTCGACCAGCTCCCTCATGGGC
ATCGACGCTGAAGCCACAGTGCCCGCCGAAGAACGAACTGCTCTGTTGGATAGGGCTGCTGACCAGAGAACAGAG
TATACTAGCGGTGCAGCCACGCCCAGCACCTTCTACAATGCCGGGAAAGACCCCTCTGTCCTTTCAAAGCGTCTC
AAGTATTATATACCCTCGTTGGCGTGGATCCCCAAGTATTCTGTCAGTTTGATTGGAGGCGATGTCCTAGCTGGC
CTGACGGTGGCTTCGGTGCTTATACCACAGTCCGTCAGTTATGCAACCTCCCTCGCCAAAATCAGCCCGGTTACT
GGCTTGATTTCAGCTTCTGTCCCAGGTATCATATATGCGTTCCTCGGTACCTCGAGGCAGCTGAATGTGGCACCA
GAGGCAGCAACAAGTCTCTTGGTGGGCCAAGCTGTGGCTGATATTTTGCATGATCACACTGGAGATGATGTGGCA
ACGCTGGGCCTCATCATTTCCACCGCTATAACTCTACAAGCTGGCCTGATTGAATTTCTTCTTGGATTCTTTCGA
TTAGGATTTATCGATGTCGTTCTCAGTCGAGCATTGCTTCGTGGCTTCATCACTGCTGTGGCTGTTGTCATCATG
GTGGAACAACTTATACCCATGTTCGATCATCTTTCTATGTCAATATGCCTGGTCAAATTACCACCCGCTATCGAC
CGTCTGCTCCTTGTTGTCATTGCATCCACAGTACTTTCTGCCCATTATCAGTGGGATGAAGACGGCTTGGACATT
CTTGGCTCTGTGAAAGTCACGACCGGCAGCTCTTTCTTTGTATCTCCCTTCACTACAAAAACCCTGAAATATGCC
CATAGCACGACATCTACTGCTTTCATTATTTCGATTGTAGGCTTCCTTGACAGTATTGTTGCCGCGAAGCAGAAT
GCCGCCCATTTTGGGTACTCAATAAGCCCGAATCGTGAGTTGGTAGCCCTGGGAGCTGCTAATGTTGGAGCGTCG
TTTATTCCTGGAACGCTTCCTGCCTTCGGATCTATCACGCGCTCACGCATTAATGGCGATGTTGGCGGTCGAACG
CAAATGGCCTCACTCGTTTGTTCCGCAGTCGTGTTGCTGGCAACGTTTGTTTTTCTCCCTTGGATGTACTATCTT
CCCAAATGTGTTCTTGCTGTTGTGATCACCCTGATCATCTTCTCCCTTCTTGCAGAGACGCCCCATGACGTTGTT
TACTATTGGAGAATGGGTGCATGGATCGATCTTGGCCTCATGTTCCTCACGTTCGTTTGCTCCATCGTCTACAAT
GTCGAAGTCGGAATTGTCGTCAGTTTGATCATCTCTCTGCTCCTCTTGGTTCATCGGTCTTCGAAGACCCGGATG
ACAATTTTGGGACGTGTTCATGGGACGGACAGATGGAGGCCTGTGAATGAAGATCCTGAAGCGGAGGAGGATGTT
CCTGGAGTTCTCGTCATTCGCATTCGGGAGAACCTGGATTTCGCTAACACGGCCCAACTTAAAGAACGTCTGCGC
CGCTTGGAGCTGTATGGTCCGATTAAAACACATCCATCAGAAGCACCTATGAGGCAAGAGACGACCGTTATTGTC
TTCCACATGGCTGATGTTGACAAATGTGACGCTTCTGCCATGCAGATCTTCTACGAACTACTTGAAGAGTACAAG
GTCAGAGGAGTCGACCTGTTCATTACACACCTCAAAAACAAGCCGCAGCGACAATTCATGCAGGCTGGTATTTGG
GACCTGCTTGGTGCTGATGCTTTCCGGCAGACTGTTGCTGATGCTATATCCATCGTGGAAGCTTCCAACCAGTAA
Transcript >AgabiH97|049030
ATGGCGTCCACTCCCCCCCACCGCAGCTTCTCCTCTGCCCACAGCCTCGCAAACTCGACCAGCTCCCTCATGGGC
ATCGACGCTGAAGCCACAGTGCCCGCCGAAGAACGAACTGCTCTGTTGGATAGGGCTGCTGACCAGAGAACAGAG
TATACTAGCGGTGCAGCCACGCCCAGCACCTTCTACAATGCCGGGAAAGACCCCTCTGTCCTTTCAAAGCGTCTC
AAGTATTATATACCCTCGTTGGCGTGGATCCCCAAGTATTCTGTCAGTTTGATTGGAGGCGATGTCCTAGCTGGC
CTGACGGTGGCTTCGGTGCTTATACCACAGTCCGTCAGTTATGCAACCTCCCTCGCCAAAATCAGCCCGGTTACT
GGCTTGATTTCAGCTTCTGTCCCAGGTATCATATATGCGTTCCTCGGTACCTCGAGGCAGCTGAATGTGGCACCA
GAGGCAGCAACAAGTCTCTTGGTGGGCCAAGCTGTGGCTGATATTTTGCATGATCACACTGGAGATGATGTGGCA
ACGCTGGGCCTCATCATTTCCACCGCTATAACTCTACAAGCTGGCCTGATTGAATTTCTTCTTGGATTCTTTCGA
TTAGGATTTATCGATGTCGTTCTCAGTCGAGCATTGCTTCGTGGCTTCATCACTGCTGTGGCTGTTGTCATCATG
GTGGAACAACTTATACCCATGTTCGATCATCTTTCTATGTCAATATGCCTGGTCAAATTACCACCCGCTATCGAC
CGTCTGCTCCTTGTTGTCATTGCATCCACAGTACTTTCTGCCCATTATCAGTGGGATGAAGACGGCTTGGACATT
CTTGGCTCTGTGAAAGTCACGACCGGCAGCTCTTTCTTTGTATCTCCCTTCACTACAAAAACCCTGAAATATGCC
CATAGCACGACATCTACTGCTTTCATTATTTCGATTGTAGGCTTCCTTGACAGTATTGTTGCCGCGAAGCAGAAT
GCCGCCCATTTTGGGTACTCAATAAGCCCGAATCGTGAGTTGGTAGCCCTGGGAGCTGCTAATGTTGGAGCGTCG
TTTATTCCTGGAACGCTTCCTGCCTTCGGATCTATCACGCGCTCACGCATTAATGGCGATGTTGGCGGTCGAACG
CAAATGGCCTCACTCGTTTGTTCCGCAGTCGTGTTGCTGGCAACGTTTGTTTTTCTCCCTTGGATGTACTATCTT
CCCAAATGTGTTCTTGCTGTTGTGATCACCCTGATCATCTTCTCCCTTCTTGCAGAGACGCCCCATGACGTTGTT
TACTATTGGAGAATGGGTGCATGGATCGATCTTGGCCTCATGTTCCTCACGTTCGTTTGCTCCATCGTCTACAAT
GTCGAAGTCGGAATTGTCGTCAGTTTGATCATCTCTCTGCTCCTCTTGGTTCATCGGTCTTCGAAGACCCGGATG
ACAATTTTGGGACGTGTTCATGGGACGGACAGATGGAGGCCTGTGAATGAAGATCCTGAAGCGGAGGAGGATGTT
CCTGGAGTTCTCGTCATTCGCATTCGGGAGAACCTGGATTTCGCTAACACGGCCCAACTTAAAGAACGTCTGCGC
CGCTTGGAGCTGTATGGTCCGATTAAAACACATCCATCAGAAGCACCTATGAGGCAAGAGACGACCGTTATTGTC
TTCCACATGGCTGATGTTGACAAATGTGACGCTTCTGCCATGCAGATCTTCTACGAACTACTTGAAGAGTACAAG
GTCAGAGGAGTCGACCTGTTCATTACACACCTCAAAAACAAGCCGCAGCGACAATTCATGCAGGCTGGTATTTGG
GACCTGCTTGGTGCTGATGCTTTCCGGCAGACTGTTGCTGATGCTATATCCATCGTGGAAGCTTCCAACCAGTAA
Gene >AgabiH97|049030
ATGGCGTCCACTCCCCCCCACCGCAGCTTCTCCTCTGCCCACAGCCTCGCAAACTCGACCAGCTCCCTCATGGGC
ATCGACGCTGAAGCCACAGTGCCCGCCGAAGAACGAACTGCTCTGTTGGATAGGGCTGCTGACCAGAGAACAGAG
TATACTAGCGGTGCAGCCACGCCCAGCACCTGTACGTTTTTTCAACTTGCGGAACTACTCCTGGCTTTCGTTTCA
ATACTCACCAGACATCTGTCAGTCTACAATGCCGGGAAAGACCCCTCTGTCCTTTCAAAGCGTCTCAAGTATTAT
ATACCCTCGTTGGCGTGGATCCCCAAGTATTCTGTCAGTTTGTACGTGCTTTCGCGTCGTGCAACGTTGTTTCCA
TCAGGGCTAAAATCGCTCACCGACCAGGATTGGAGGCGATGTCCTAGCTGGCCTGACGGTGGCTTCGGTGCTTAT
ACCACAGTCCGTCAGTTATGCAACCTCCCTCGCCAAAATCAGCCCGGTTACTGGCTTGGTACGTTCTTCCGTAGC
GGCTGATTTGATACCAGCGCCATTTCTCATAGTCTATTTTTTTCTCCTAGATTTCAGCTTCTGTCCCAGGTATCA
TATATGCGTTCCTCGGTACCTCGAGGCAGCTGAATGTGGCACCAGAGGCAGCAACAAGTCTCTTGGTGGGCCAAG
CTGTGGCTGATATTTTGCATGATCACACTGGAGATGATGTGGCAACGCTGGGCCTCATCATTTCCACCGCTATAA
CTCTACAAGTGAGTCGCCCCAGCTCCCCTGTTCAAGGAAAAGGCCCAGTTGATTATGTACTTCATCAAGGCTGGC
CTGATTGAATTTCTTCTTGGATTCTTTCGATTAGGATTTATCGATGTCGTTCTCAGTCGAGCATTGCTTCGTGGC
TTCATCACTGCTGTGGCTGTTGTCATCATGGTGTACGTTTGTTCTTGGATTTTCTTTCCATTATCATGCTTATGT
TATCCAGGGAACAACTTATACCCATGTTCGGTTTAACCCATCTATCACATGAGCTTGATCTTGAAACGACCTTGG
ACAAGATCATCTTTCTATGTCAATATGCCTGGTCAAATTACCACCCGCTATCGACCGTCGTAAGTTTCGGGGCAT
TATTTACCCTGATTGCCATCCGCTCTGCAAAAAACCAGCTCAAAAAATACTGGTTTATTTATCGTATTCCCGAAG
TGCTCCTTGTTGTCATTGCATCCACAGGTATGGTCTCATATTTCTATCATCTAGCAGAAATTAACTTTGTTTACC
AGTACTTTCTGCCCATTATCAGTGGGATGAAGACGGCTTGGACATTCTTGGCTCTGTGAAAGTCACGACCGGCAG
CTCTTTCTTTGTATCTCCCTTCACTACAAAAACCCTGAAATATGCCCATAGCACGACATCTACTGCTTTGTAAGT
CCATATCTTACCTCCTCCAGTGCACCCCTTTCACAAGATATTTGCAGCATTATTTCGATTGTAGGCTTCCTTGAC
AGTATTGTTGCCGCGAAGCAGAATGCCGCCCATTTTGGGTACTCAATAAGCCCGAATCGTGAGTTGGTAGCCCTG
GGAGCTGCTAATGTTGGAGCGTCGTTTATTCCTGGAACGCTTCCTGCCTTCGGATCTATCACGCGCTCACGCATT
AATGGCGATGTTGGCGGTCGAACGCAAATGGCCTCACTCGTTTGTTCCGCAGTCGTGTTGCTGGCAACGTTTGTT
TTTCTCCCTTGGATGTACTATCTTCCCAAATGTGTTCTTGCTGTTGTGTGAGTGTTTAGAATGGGTGTATGGCGA
TGCAGAAGTGTTAACATAGCTATTTTAGGATCACCCTGATCATCTTCTCCCTTCTTGCAGAGACGCCCCATGACG
TTGTTTACTATTGGAGGTCAGTAACGTGTGCAAGTATCGAGCAGCTATGAATTTCTGACGCGACGGTGAAAACTA
GAATGGGTGCATGGATCGATCTTGGCCTCATGTTCCTCACGTTCGTTTGCTCCATCGTCTACAATGTCGAAGTCG
GAATTGTCGTCAGTTTGATCATCTCTCTGCTCCTCTTGGTTCATCGGTCTTCGAAGACCCGGATGACAATTTTGG
GACGTGTTCATGGGACGGACAGATGGAGGCCTGTGAATGAAGATCCTGAAGCGGAGGAGGATGTTCCTGGAGTTC
TCGTCATTCGCATTCGGGAGAACCTGGATTTCGCTAACACGGCCCAACTTAAAGGTGGGTCGCACTTCCTGTGGC
CTAACATAAGAGGATAGAACTAAGCAAGTGCTATAGAACGTCTGCGCCGCTTGGAGCTGTATGGTCCGATTAAAA
CACATCCATCAGAAGCACCTATGAGGCAAGAGACGACCGTTATTGTCTTCCACATGGCTGATGTTGACAAATGTG
ACGCTTCGTGAGTTTTTATAGCCGATCATTTGGTTTTCATTCGCTCACGGACAACGTAGTGCCATGCAGATCTTC
TACGAACTACTTGAAGAGTACAAGGTACGTTATTTATCACTCAAAAGAATGACGAATCACGACATCTCATCATTC
TTGAAACAGGTCAGAGGAGTCGACCTGTTCATTACACACCTCAAAAACAAGCCGCAGCGACAATTCATGCAGGCT
GGTATTTGGGACCTGCTTGGTGCTGATGCTTTCCGGCAGACTGTTGCTGATGCTATATCCATCGTGGAAGCTTCC
AACCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail