Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048970
Gene name
Locationscaffold_2:2594322..2597574
Strand+
Gene length (bp)3252
Transcript length (bp)2925
Coding sequence length (bp)2925
Protein length (aa) 975

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 9.3E-146 346 803
PF13802 Gal_mutarotas_2 Galactose mutarotase-like 4.4E-16 250 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 26 973 0.0E+00
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 20 966 0.0E+00
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 4 973 0.0E+00
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 167 934 0.0E+00
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 26 973 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 26 973 0.0E+00
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 20 966 0.0E+00
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 4 973 0.0E+00
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 167 934 0.0E+00
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 26 973 0.0E+00
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 20 973 0.0E+00
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 1 973 0.0E+00
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 9 971 0.0E+00
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 9 971 0.0E+00
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 4 971 0.0E+00
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 19 971 0.0E+00
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 6 971 0.0E+00
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 279 853 2.0E-107
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 341 864 7.0E-90
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 238 892 6.0E-87
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 220 849 5.0E-84
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 238 846 9.0E-84
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 238 844 7.0E-83
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 329 892 5.0E-82
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 288 842 2.0E-80
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 292 844 3.0E-80
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 236 971 1.0E-75
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 341 846 3.0E-75
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 341 846 4.0E-74
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 278 974 4.0E-74
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 236 971 7.0E-73
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 341 846 2.0E-70
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 341 863 4.0E-70
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 341 846 1.0E-69
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 341 859 1.0E-68
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 341 863 2.0E-67
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 338 863 2.0E-67
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 267 804 6.0E-65
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 267 804 7.0E-65
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 292 879 4.0E-64
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 336 866 6.0E-63
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 341 861 1.0E-61
sp|B3PEE6|OL4AG_CELJU Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=agd31B PE=1 SV=1 304 843 8.0E-61
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 341 858 3.0E-60
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 548 907 3.0E-58
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 341 846 1.0E-55
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 341 863 1.0E-51
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 542 925 2.0E-50
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 544 844 2.0E-49
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 548 897 3.0E-48
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 273 833 3.0E-48
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 548 844 4.0E-48
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 544 847 1.0E-47
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 553 852 2.0E-47
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 553 852 2.0E-47
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 544 844 6.0E-46
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 544 844 6.0E-46
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 544 848 7.0E-46
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 548 844 2.0E-44
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 541 922 2.0E-44
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 544 865 3.0E-44
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 548 931 7.0E-44
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 544 865 3.0E-40
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 329 850 3.0E-40
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 322 804 1.0E-37
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 327 760 2.0E-37
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 544 842 1.0E-32
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 236 538 2.0E-27
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 236 538 2.0E-27
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 236 538 3.0E-27
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 238 547 5.0E-27
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 238 547 6.0E-27
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 236 538 1.0E-26
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 293 538 1.0E-26
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 236 538 1.0E-26
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 236 538 3.0E-26
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 236 538 3.0E-26
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 341 538 1.0E-22
sp|A2QTU5|XYLA_ASPNC Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axlA PE=1 SV=1 358 799 4.0E-22
sp|Q01336|YCR2_ESCVU Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Escherichia vulneris PE=3 SV=1 324 675 9.0E-22
sp|P32138|YIHQ_ECOLI Alpha-glucosidase YihQ OS=Escherichia coli (strain K12) GN=yihQ PE=1 SV=3 422 801 9.0E-22
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 336 538 5.0E-19
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 341 538 5.0E-18
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 315 538 1.0E-17
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 330 538 1.0E-17
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 352 545 6.0E-17
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 336 538 1.0E-16
sp|Q6NSJ0|K1161_HUMAN Uncharacterized family 31 glucosidase KIAA1161 OS=Homo sapiens GN=KIAA1161 PE=1 SV=2 407 761 7.0E-14
sp|Q69ZQ1|K1161_MOUSE Uncharacterized family 31 glucosidase KIAA1161 OS=Mus musculus GN=Kiaa1161 PE=1 SV=2 371 761 2.0E-12
sp|P19965|SP15_TORCA SITS-binding protein OS=Torpedo californica PE=1 SV=2 612 801 6.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048970
MRPWTLLGLVVFLLVEDGFAFKDHDFKNCSQSGFCRRGRALAARAKEAKDAWKSPYSLVADSVTVNPADATFTAR
VKSSLYPDIKFGLELRVHHDGVVRVRMDEIDGLRKRYDQAASWALIAEPKISDSIRWTAGKKDIRAVYGAKKEIE
VVVSYEPLRVALIRNGKEQVVLNGQGLLHMEHFRNKDGQEGGDGAAQEVLKAENPPPREWFEGDKEDDYWEEKWI
SWTDTKPKGPESLSLDITYPNHGTVYGIPQHATRLALPTTTGENSFFSDPYRFYNADVFEYLASSPVSIYGSIPV
MHAHSADSTVGIFNAVASETWIDVSHASKKSTETHWISESGIMDLFLLPGPTPEDIFKQYATLTGSPVLPAQWAL
GYHQCRWNYMTSDDIRSVQKRFDEDDIPFDVLWLDIEYSEDHKYFIWNKKNFPDPVDMVNDVAALGRKMVVIIDP
HLKRTEEYPVYQQASERGLLVKTSNGEGEYEGLCWSGKSSWMDFFNPNAWDWWKSLFKTQSLPGGAWSWTESTED
VHIWNDMNEPSVFNGPEITMPKDSIHYDGWEHRDVHNLNGMLFSNHTWQAVYERSDPPKRPFVLTRSYYAGSQRF
GALWTGDNLGTWEHMAVGIKMTLSNSIAGMGFVGSDVGGFFGNPEPEMLVRWYQVGAFAPFFRAHAHIDAKRREP
YLLEEPYKSYVRDILRLRYSLLPVWYTQFRETTVTGMPIMRPHYVVFPKDKNGFDLDDQYFIGSSGILVRPVTEK
GATEASVYLPAENQPYYDYFNLNIFRSTTKGKTITVPAALDQIPVFIRGGSIIPTRERPRRASTAMKLDPFTLRI
GLSKDGMARGELYLDDGESYDHQKGQLIWREFNADKTSGKKVKKPLLRISSRDMASHEPEAAVDGVSLKTYTSEN
PFAQSISDVRVERIVVAGLNKKPKSVKVDGDDGELIWEWIDGVSAGDKKEGESSVLIVRDPKVLIVKDWSIVIE*
Coding >AgabiH97|048970
ATGCGCCCGTGGACGCTGCTTGGTCTCGTAGTCTTTCTGCTCGTGGAGGACGGGTTTGCGTTCAAAGACCATGAT
TTCAAGAACTGCTCCCAGTCAGGCTTCTGCAGGCGCGGCCGAGCTCTAGCTGCACGTGCTAAGGAGGCTAAGGAT
GCCTGGAAGTCTCCCTACTCGCTCGTCGCAGATTCAGTCACCGTGAACCCGGCCGACGCTACCTTCACCGCTCGC
GTCAAGTCTTCCTTATACCCCGATATCAAATTCGGCCTCGAGCTGCGTGTTCACCACGATGGTGTCGTCCGAGTC
CGCATGGACGAGATTGATGGCCTTCGGAAAAGATATGATCAGGCAGCATCCTGGGCTCTAATTGCCGAGCCAAAA
ATAAGCGACTCCATTAGATGGACTGCTGGAAAGAAGGACATTCGTGCGGTTTACGGGGCGAAGAAGGAAATCGAA
GTTGTAGTTTCGTATGAGCCCCTTCGCGTCGCGCTTATCCGAAACGGCAAGGAGCAGGTCGTTCTTAACGGCCAA
GGGCTCTTGCACATGGAACATTTCCGGAACAAAGATGGACAGGAGGGAGGTGACGGTGCTGCCCAGGAAGTGTTG
AAGGCTGAAAATCCTCCTCCTAGAGAGTGGTTTGAAGGGGATAAAGAGGATGACTACTGGGAGGAAAAATGGATA
TCTTGGACGGATACAAAGCCCAAAGGTCCTGAATCGCTTTCTCTCGATATCACATACCCAAATCATGGCACCGTG
TACGGAATCCCTCAACATGCTACCCGCCTGGCCTTACCCACTACGACCGGAGAGAATTCTTTCTTCTCCGATCCC
TACCGTTTCTACAATGCCGACGTCTTTGAATACCTAGCCTCGTCCCCCGTTTCCATTTACGGTTCTATTCCGGTC
ATGCACGCTCATTCTGCGGACTCGACCGTCGGTATTTTCAATGCTGTGGCCTCCGAAACTTGGATTGACGTTTCT
CATGCGTCCAAGAAATCAACGGAGACCCATTGGATCTCCGAGTCTGGAATTATGGACCTCTTCCTTCTCCCCGGT
CCTACTCCAGAAGATATCTTCAAGCAGTATGCCACTTTGACCGGATCTCCTGTACTTCCCGCACAGTGGGCACTG
GGTTACCATCAATGTCGATGGAATTACATGACTTCGGATGACATTCGCAGTGTACAGAAGCGTTTCGATGAAGAT
GATATACCTTTTGATGTCCTATGGTTGGACATTGAATACTCGGAGGACCACAAGTATTTCATCTGGAACAAAAAG
AACTTCCCTGACCCTGTGGATATGGTGAACGATGTTGCTGCCCTTGGTCGCAAAATGGTCGTCATCATCGACCCC
CATCTCAAGCGCACCGAAGAATATCCAGTATACCAGCAGGCTTCCGAGAGGGGTCTCCTCGTCAAAACCAGCAAC
GGCGAAGGAGAGTATGAAGGCTTGTGTTGGTCGGGTAAGAGCTCTTGGATGGATTTCTTCAATCCTAACGCTTGG
GACTGGTGGAAATCGTTGTTCAAGACTCAATCACTTCCTGGCGGCGCTTGGTCCTGGACGGAGAGCACTGAGGAT
GTCCATATCTGGAACGACATGAATGAGCCATCGGTTTTCAATGGTCCGGAAATTACGATGCCCAAGGACTCCATT
CATTATGATGGCTGGGAGCACCGCGATGTACATAACCTTAATGGTATGCTCTTTTCCAACCATACATGGCAGGCC
GTCTACGAGCGCTCTGATCCACCCAAACGTCCTTTCGTCCTCACGCGTTCCTACTACGCCGGCTCTCAACGTTTC
GGTGCTCTTTGGACCGGCGATAACTTGGGAACTTGGGAACACATGGCTGTCGGAATCAAGATGACGTTGTCCAAC
AGTATCGCGGGTATGGGTTTTGTCGGATCTGACGTTGGCGGTTTCTTTGGTAATCCCGAACCGGAAATGCTTGTT
CGTTGGTACCAAGTTGGTGCTTTTGCACCCTTCTTCCGCGCGCATGCCCATATCGATGCTAAGCGCCGTGAACCT
TACTTGCTTGAAGAGCCGTACAAGTCGTACGTGCGCGACATCCTTCGCTTGAGGTACAGCCTCCTGCCGGTCTGG
TACACTCAATTCCGTGAAACGACTGTCACCGGTATGCCTATCATGAGGCCTCATTATGTTGTGTTCCCCAAGGAC
AAGAACGGTTTCGATTTGGACGATCAATATTTCATTGGTTCTTCCGGCATTCTCGTCAGACCTGTCACCGAGAAA
GGCGCTACAGAAGCCTCCGTTTACCTTCCTGCCGAGAATCAACCTTACTATGACTATTTTAATCTCAATATCTTC
CGTTCCACCACCAAGGGCAAAACCATCACTGTCCCCGCAGCTCTTGACCAAATTCCCGTATTCATTCGAGGAGGA
TCTATTATTCCTACACGTGAACGACCTCGTCGCGCATCCACAGCTATGAAGCTTGATCCCTTTACTCTTCGTATT
GGATTAAGCAAAGATGGGATGGCTCGTGGGGAGCTTTACTTAGATGATGGTGAATCGTATGATCATCAAAAGGGA
CAACTCATTTGGAGAGAATTTAATGCGGACAAGACATCGGGAAAGAAAGTCAAGAAACCACTTTTGAGGATTTCG
AGTCGGGATATGGCTTCACATGAACCTGAAGCTGCAGTGGATGGCGTATCATTGAAGACGTATACTTCTGAGAAT
CCGTTTGCGCAGAGTATAAGTGATGTGAGGGTTGAGAGGATTGTTGTGGCGGGATTGAATAAGAAACCGAAGAGC
GTGAAGGTGGATGGGGATGATGGGGAATTGATTTGGGAATGGATTGATGGTGTTTCTGCGGGTGATAAGAAGGAA
GGGGAGAGTAGTGTTTTGATTGTGAGGGATCCGAAGGTGTTGATTGTGAAGGATTGGAGTATTGTTATTGAATAG
Transcript >AgabiH97|048970
ATGCGCCCGTGGACGCTGCTTGGTCTCGTAGTCTTTCTGCTCGTGGAGGACGGGTTTGCGTTCAAAGACCATGAT
TTCAAGAACTGCTCCCAGTCAGGCTTCTGCAGGCGCGGCCGAGCTCTAGCTGCACGTGCTAAGGAGGCTAAGGAT
GCCTGGAAGTCTCCCTACTCGCTCGTCGCAGATTCAGTCACCGTGAACCCGGCCGACGCTACCTTCACCGCTCGC
GTCAAGTCTTCCTTATACCCCGATATCAAATTCGGCCTCGAGCTGCGTGTTCACCACGATGGTGTCGTCCGAGTC
CGCATGGACGAGATTGATGGCCTTCGGAAAAGATATGATCAGGCAGCATCCTGGGCTCTAATTGCCGAGCCAAAA
ATAAGCGACTCCATTAGATGGACTGCTGGAAAGAAGGACATTCGTGCGGTTTACGGGGCGAAGAAGGAAATCGAA
GTTGTAGTTTCGTATGAGCCCCTTCGCGTCGCGCTTATCCGAAACGGCAAGGAGCAGGTCGTTCTTAACGGCCAA
GGGCTCTTGCACATGGAACATTTCCGGAACAAAGATGGACAGGAGGGAGGTGACGGTGCTGCCCAGGAAGTGTTG
AAGGCTGAAAATCCTCCTCCTAGAGAGTGGTTTGAAGGGGATAAAGAGGATGACTACTGGGAGGAAAAATGGATA
TCTTGGACGGATACAAAGCCCAAAGGTCCTGAATCGCTTTCTCTCGATATCACATACCCAAATCATGGCACCGTG
TACGGAATCCCTCAACATGCTACCCGCCTGGCCTTACCCACTACGACCGGAGAGAATTCTTTCTTCTCCGATCCC
TACCGTTTCTACAATGCCGACGTCTTTGAATACCTAGCCTCGTCCCCCGTTTCCATTTACGGTTCTATTCCGGTC
ATGCACGCTCATTCTGCGGACTCGACCGTCGGTATTTTCAATGCTGTGGCCTCCGAAACTTGGATTGACGTTTCT
CATGCGTCCAAGAAATCAACGGAGACCCATTGGATCTCCGAGTCTGGAATTATGGACCTCTTCCTTCTCCCCGGT
CCTACTCCAGAAGATATCTTCAAGCAGTATGCCACTTTGACCGGATCTCCTGTACTTCCCGCACAGTGGGCACTG
GGTTACCATCAATGTCGATGGAATTACATGACTTCGGATGACATTCGCAGTGTACAGAAGCGTTTCGATGAAGAT
GATATACCTTTTGATGTCCTATGGTTGGACATTGAATACTCGGAGGACCACAAGTATTTCATCTGGAACAAAAAG
AACTTCCCTGACCCTGTGGATATGGTGAACGATGTTGCTGCCCTTGGTCGCAAAATGGTCGTCATCATCGACCCC
CATCTCAAGCGCACCGAAGAATATCCAGTATACCAGCAGGCTTCCGAGAGGGGTCTCCTCGTCAAAACCAGCAAC
GGCGAAGGAGAGTATGAAGGCTTGTGTTGGTCGGGTAAGAGCTCTTGGATGGATTTCTTCAATCCTAACGCTTGG
GACTGGTGGAAATCGTTGTTCAAGACTCAATCACTTCCTGGCGGCGCTTGGTCCTGGACGGAGAGCACTGAGGAT
GTCCATATCTGGAACGACATGAATGAGCCATCGGTTTTCAATGGTCCGGAAATTACGATGCCCAAGGACTCCATT
CATTATGATGGCTGGGAGCACCGCGATGTACATAACCTTAATGGTATGCTCTTTTCCAACCATACATGGCAGGCC
GTCTACGAGCGCTCTGATCCACCCAAACGTCCTTTCGTCCTCACGCGTTCCTACTACGCCGGCTCTCAACGTTTC
GGTGCTCTTTGGACCGGCGATAACTTGGGAACTTGGGAACACATGGCTGTCGGAATCAAGATGACGTTGTCCAAC
AGTATCGCGGGTATGGGTTTTGTCGGATCTGACGTTGGCGGTTTCTTTGGTAATCCCGAACCGGAAATGCTTGTT
CGTTGGTACCAAGTTGGTGCTTTTGCACCCTTCTTCCGCGCGCATGCCCATATCGATGCTAAGCGCCGTGAACCT
TACTTGCTTGAAGAGCCGTACAAGTCGTACGTGCGCGACATCCTTCGCTTGAGGTACAGCCTCCTGCCGGTCTGG
TACACTCAATTCCGTGAAACGACTGTCACCGGTATGCCTATCATGAGGCCTCATTATGTTGTGTTCCCCAAGGAC
AAGAACGGTTTCGATTTGGACGATCAATATTTCATTGGTTCTTCCGGCATTCTCGTCAGACCTGTCACCGAGAAA
GGCGCTACAGAAGCCTCCGTTTACCTTCCTGCCGAGAATCAACCTTACTATGACTATTTTAATCTCAATATCTTC
CGTTCCACCACCAAGGGCAAAACCATCACTGTCCCCGCAGCTCTTGACCAAATTCCCGTATTCATTCGAGGAGGA
TCTATTATTCCTACACGTGAACGACCTCGTCGCGCATCCACAGCTATGAAGCTTGATCCCTTTACTCTTCGTATT
GGATTAAGCAAAGATGGGATGGCTCGTGGGGAGCTTTACTTAGATGATGGTGAATCGTATGATCATCAAAAGGGA
CAACTCATTTGGAGAGAATTTAATGCGGACAAGACATCGGGAAAGAAAGTCAAGAAACCACTTTTGAGGATTTCG
AGTCGGGATATGGCTTCACATGAACCTGAAGCTGCAGTGGATGGCGTATCATTGAAGACGTATACTTCTGAGAAT
CCGTTTGCGCAGAGTATAAGTGATGTGAGGGTTGAGAGGATTGTTGTGGCGGGATTGAATAAGAAACCGAAGAGC
GTGAAGGTGGATGGGGATGATGGGGAATTGATTTGGGAATGGATTGATGGTGTTTCTGCGGGTGATAAGAAGGAA
GGGGAGAGTAGTGTTTTGATTGTGAGGGATCCGAAGGTGTTGATTGTGAAGGATTGGAGTATTGTTATTGAATAG
Gene >AgabiH97|048970
ATGCGCCCGTGGACGCTGCTTGGTCTCGTAGTCTTTCTGCTCGTGGAGGACGGGTTTGCGTTCAAAGACCATGAT
TTCAAGAACTGCTCCCAGTCAGGCTTCTGCAGGCGCGGCCGAGCTCTAGCTGCACGTGCTAAGGAGGCTAAGGAT
GCCTGGAAGTCTCCCTACTCGCTCGTCGCAGATTCAGTCACCGTGAACCCGGCCGACGCTACCTTCACCGCTCGC
GTCAAGTCTTCCTTATACCCCGATATCAAATTCGGCCTCGAGCTGCGTGTTCACCACGATGGTGTCGTCCGAGTC
CGCATGGACGAGATTGATGGCCTTCGGAAAAGATATGATCAGGCAGCATCCTGGGCTCTAATTGCCGAGCCAAAA
ATAAGCGACTCCATTAGATGGACTGCTGGAAAGAAGGACATTCGTGCGGTTTACGGGGCGAAGAAGGAAATCGAA
GTTGTAGTTTCGTATGAGCCCCTTCGCGTCGCGCTTATCCGAAACGGCAAGGAGCAGGTCGTTCTTAACGGCCAA
GGGCTCTTGCACATGGAACATTTCCGGAACAAAGATGGACAGGAGGGAGGTGACGGTGCTGCCCAGGAAGTGTTG
AAGGCTGAAAATCCTCCTCCTAGAGAGTGGTTTGAAGGGGATAAAGAGGATGACTACTGGGAGGAAAAATGGATA
TCTTGGACGGATACAAAGCCCAAAGGTACATCTTGACGCTCTCTGATTCTGCGCGCTCTCATACTAAATCTATTT
TAGGTCCTGAATCGCTTTCTCTCGATATCACATACCCAAATCATGGCACCGTGTACGGAATCCCTCAACATGCTA
CCCGCCTGGCCTTACCCACTACGACCGGAGAGAATTCTTTCTTCTCCGATCCCTACCGTTTCTACAATGCCGACG
TCTTTGAATACCTAGCCTCGTCCCCCGTTTCCATTTACGGTTCTATTCCGGTCATGCACGCTCATTCTGCGGACT
CGACCGTCGGTATTTTCAATGCTGTGGCCTCCGAAACTTGGATTGACGTTTCTCATGCGTCCAAGAAATCAACGG
AGACCCATTGGATCTCCGAGTCTGGAATTATGGACCTCTTCCTTCTCCCCGGTCCTACTCCAGAAGATATCTTCA
AGCAGTATGCCACTTTGACCGGATCTCCTGTACTTCCCGCACAGTGGGCACTGGGTTACCATCAATGTCGATGGA
ATTACATGACTTCGGATGACATTCGCAGTGTACAGAAGCGTTTCGATGAAGATGATATACCTTTTGATGTCCTAT
GGTTGGACATTGAATACTCGGAGGACCACAAGTATTTCATCTGGAACAAAAAGAACTTCCCTGACCCTGTGGATA
TGGTGAACGATGTTGCTGCCCTTGGTCGCAAAGTAAGCGAATTTTTCTAGGCAGCCCCTTCTCTGATGGATATGG
CTAATGCATGTAAAAGATGGTCGTCATCATCGACCCCCATCTCAAGCGCACCGAAGAATATCCAGTATACCAGCA
GGCTTCCGAGAGGGGTCTCCTCGTCAAAACCAGCAACGGCGAAGGAGAGTATGAAGGCTTGTGTTGGTCGGGTAA
GAGCTCTTGGATGGATTTCTTCAATCCTAACGCTTGGGACTGGTGGAAATCGTTGTTCAAGACTCAATCACTTCC
TGGCGGCGCTTGGTCCTGGACGGAGAGCACTGAGGATGTCCATATCTGGAACGACATGAATGAGGTTCGTAATGG
TATTTGTCAGTGATTTCGCTCTAATGTACCTTCCTTAGCCATCGGTTTTCAATGGTCCGGAAATTACGATGCCCA
AGGACTCCATTCATTATGATGGCTGGGAGCACCGCGATGTACATAACCTTAATGGTATGCTCTTTGTGAGTAACC
CAATCTACTGTTGTCTCTATGGGAGCTCATGTTTCCGTCATGTTAGTCCAACCATACATGGCAGGCCGTCTACGA
GCGCTCTGATCCACCCAAACGTCCTTTCGTCCTCACGCGTTCCTACTACGCCGGCTCTCAACGTTTCGGTGCTCT
TTGGACCGGCGATAACTTGGGAACTTGGGAACACATGGCTGTCGGAATCAAGATGACGTTGTCCAACAGTATCGC
GGGTATGGGTTTTGTCGGATGTAAGCGTCCCCCCCCCAAAAGCCTTAGGAATATACTCAAAAATTTATTTCGACA
GCTGACGTTGGCGGTTTCTTTGGTAATCCCGAACCGGAAATGCTTGTTCGTTGGTACCAAGTTGGTGCTTTTGCA
CCCTTCTTCCGCGCGCATGCCCATATCGATGCTAAGCGCCGTGAACCTTACTTGCTTGAAGAGCCGTACAAGTCG
TACGTGCGCGACATCCTTCGCTTGAGGTACAGCCTCCTGCCGGTCTGGTACACTCAATTCCGTGAAACGACTGTC
ACCGGTATGCCTATCATGAGGTAAGTTATGTTCTAAATAATGGTGTTCCTATCTGACGCATGCACCTTTCAAAGG
CCTCATTATGTTGTGTTCCCCAAGGACAAGAACGGTTTCGATTTGGACGATCAATATTTCATTGGTTCTTCCGGC
ATTCTCGTCAGACCTGTCACCGAGAAAGGCGCTACAGAAGCCTCCGTTTACCTTCCTGCCGAGAATCAACCTTAC
TATGACTATTTTAATCTCAATATCTTCCGTTCCACCACCAAGGGCAAAACCATCACTGTCCCCGCAGCTCTTGAC
CAAATTCCCGTATTCATTCGAGGAGGATCTATTATTCCTACACGTGAACGACCTCGTCGCGCATCCACAGCTATG
AAGCTTGATCCCTTTACTCTTCGTATTGGATTAAGCAAAGATGGGATGGCTCGTGGGGAGCTTTACTTAGATGAT
GGTGAATCGTATGATCATCAAAAGGGACAACTCATTTGGAGAGAATTTAATGCGGACAAGACATCGGGAAAGAAA
GTCAAGAAACCACTTTTGAGGATTTCGAGTCGGGATATGGCTTCACATGAACCTGAAGCTGCAGTGGATGGCGTA
TCATTGAAGACGTATACTTCTGAGAATCCGTTTGCGCAGAGTATAAGTGATGTGAGGGTTGAGAGGATTGTTGTG
GCGGGATTGAATAAGAAACCGAAGAGCGTGAAGGTGGATGGGGATGATGGGGAATTGATTTGGGAATGGATTGAT
GGTGTTTCTGCGGGTGATAAGAAGGAAGGGGAGAGTAGTGTTTTGATTGTGAGGGATCCGAAGGTGTTGATTGTG
AAGGATTGGAGTATTGTTATTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail