Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048680
Gene name
Locationscaffold_2:2533481..2534807
Strand+
Gene length (bp)1326
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01650 Peptidase_C13 Peptidase C13 family 2.0E-44 42 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49018|GPI8_YEAST GPI-anchor transamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI8 PE=1 SV=1 37 316 1.0E-138
sp|Q5R6L8|GPI8_PONAB GPI-anchor transamidase OS=Pongo abelii GN=PIGK PE=2 SV=1 37 311 1.0E-125
sp|Q92643|GPI8_HUMAN GPI-anchor transamidase OS=Homo sapiens GN=PIGK PE=1 SV=2 37 311 2.0E-125
sp|Q9CXY9|GPI8_MOUSE GPI-anchor transamidase OS=Mus musculus GN=Pigk PE=1 SV=2 37 311 2.0E-125
sp|Q3MHZ7|GPI8_BOVIN GPI-anchor transamidase OS=Bos taurus GN=PIGK PE=2 SV=1 37 311 6.0E-124
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49018|GPI8_YEAST GPI-anchor transamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI8 PE=1 SV=1 37 316 1.0E-138
sp|Q5R6L8|GPI8_PONAB GPI-anchor transamidase OS=Pongo abelii GN=PIGK PE=2 SV=1 37 311 1.0E-125
sp|Q92643|GPI8_HUMAN GPI-anchor transamidase OS=Homo sapiens GN=PIGK PE=1 SV=2 37 311 2.0E-125
sp|Q9CXY9|GPI8_MOUSE GPI-anchor transamidase OS=Mus musculus GN=Pigk PE=1 SV=2 37 311 2.0E-125
sp|Q3MHZ7|GPI8_BOVIN GPI-anchor transamidase OS=Bos taurus GN=PIGK PE=2 SV=1 37 311 6.0E-124
sp|Q9USP5|GPI8_SCHPO GPI-anchor transamidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi8 PE=2 SV=1 35 311 3.0E-123
sp|Q4KRV1|GPI8_PIG GPI-anchor transamidase OS=Sus scrofa GN=PIGK PE=2 SV=1 6 311 4.0E-123
sp|Q8T4E1|GPI8_DROME Putative GPI-anchor transamidase OS=Drosophila melanogaster GN=CG4406 PE=2 SV=1 33 311 1.0E-113
sp|P49048|GPI8_CAEEL Putative GPI-anchor transamidase OS=Caenorhabditis elegans GN=T05E11.6 PE=1 SV=3 1 319 8.0E-100
sp|O89017|LGMN_MOUSE Legumain OS=Mus musculus GN=Lgmn PE=1 SV=1 41 302 2.0E-28
sp|Q9R0J8|LGMN_RAT Legumain OS=Rattus norvegicus GN=Lgmn PE=1 SV=1 41 302 3.0E-28
sp|Q4R4T8|LGMN_MACFA Legumain OS=Macaca fascicularis GN=LGMN PE=2 SV=1 13 302 1.0E-27
sp|Q5R5D9|LGMN_PONAB Legumain OS=Pongo abelii GN=LGMN PE=2 SV=1 41 302 2.0E-27
sp|Q99538|LGMN_HUMAN Legumain OS=Homo sapiens GN=LGMN PE=1 SV=1 41 302 2.0E-27
sp|Q95M12|LGMN_BOVIN Legumain OS=Bos taurus GN=LGMN PE=1 SV=1 41 276 3.0E-27
sp|P09841|HGLB_SCHMA Hemoglobinase OS=Schistosoma mansoni PE=1 SV=3 3 276 2.0E-25
sp|P42665|HGLB_SCHJA Hemoglobinase OS=Schistosoma japonicum GN=HAEM PE=2 SV=1 4 279 4.0E-25
sp|Q9LJX8|VPED_ARATH Vacuolar-processing enzyme delta-isozyme OS=Arabidopsis thaliana GN=dVPE PE=1 SV=1 2 217 1.0E-24
sp|P49047|VPEA_ARATH Vacuolar-processing enzyme alpha-isozyme OS=Arabidopsis thaliana GN=At2g25940 PE=2 SV=2 40 230 2.0E-21
sp|P49043|VPE_CITSI Vacuolar-processing enzyme OS=Citrus sinensis PE=2 SV=1 43 231 4.0E-20
sp|Q84LM2|VPE1_ORYSJ Vacuolar-processing enzyme beta-isozyme 1 OS=Oryza sativa subsp. japonica GN=VPE1 PE=1 SV=1 43 231 1.0E-19
sp|P49046|LEGU_CANEN Legumain OS=Canavalia ensiformis PE=1 SV=1 3 231 3.0E-19
sp|P49044|VPE_VICSA Vacuolar-processing enzyme OS=Vicia sativa PE=1 SV=1 43 232 5.0E-19
sp|Q39044|VPEB_ARATH Vacuolar-processing enzyme beta-isozyme OS=Arabidopsis thaliana GN=bVPE PE=2 SV=3 43 230 5.0E-19
sp|B8ASK4|VPE1_ORYSI Vacuolar-processing enzyme beta-isozyme 1 OS=Oryza sativa subsp. indica GN=OsI_16797 PE=3 SV=1 43 231 1.0E-18
sp|Q39119|VPEG_ARATH Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana GN=At4g32940 PE=2 SV=2 43 230 4.0E-18
sp|O24326|VPE2_PHAVU Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=2 SV=1 43 230 5.0E-18
sp|O24325|VPE1_PHAVU Vacuolar-processing enzyme OS=Phaseolus vulgaris PE=1 SV=1 24 230 1.0E-17
sp|P49045|VPE_SOYBN Vacuolar-processing enzyme OS=Glycine max PE=2 SV=1 43 230 2.0E-16
sp|P49042|VPE_RICCO Vacuolar-processing enzyme OS=Ricinus communis PE=1 SV=1 43 209 5.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0008233 peptidase activity Yes
GO:0006508 proteolysis Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048680
MRLILFLHLLGILYTTWALNAQPVNDFFERNAAPGASKHTNNWAVLVCASRYWFNYRHMANALGMYRTVKRLGIP
DSNIILMLADDVSCNMRNKFPGSVYANPGRHLDLYGDNIEVDYRGYEVTVENFIRLLTGRVDPSVPRSKRLLTDE
NSNVFVYMTGHGGNEFLKFQDNEEISAFDIADAFEQMYQKKRYNEIFFMIDTCQANTMYTKFYSPNILATGSSLL
GENSYSYANDNDLGVAVIDAYTHYVLQYMEGINKTSQLTMQDLFNTYDPAKINSHPGVRSDLFQRPLNTALITDF
FGGVSQVEVASPDDSEDDEQDFVSLW*
Coding >AgabiH97|048680
ATGCGTTTGATCTTATTCCTTCATCTCCTTGGTATTCTATACACGACATGGGCACTCAACGCGCAACCCGTGAAC
GACTTCTTCGAACGCAATGCGGCGCCTGGAGCGTCTAAGCATACAAACAACTGGGCTGTTCTCGTCTGCGCATCG
CGGTACTGGTTCAACTATAGGCACATGGCCAACGCCCTCGGAATGTACCGAACTGTCAAGCGCCTTGGAATACCG
GATTCCAATATTATCCTTATGCTTGCGGATGACGTATCATGTAACATGCGAAACAAGTTTCCAGGAAGCGTTTAT
GCTAATCCTGGACGACATTTGGATCTATATGGTGACAATATTGAAGTGGACTACCGTGGATACGAGGTTACTGTC
GAAAACTTCATTAGACTTTTGACTGGTCGAGTGGATCCATCTGTTCCTCGTTCCAAACGCCTTTTGACCGATGAG
AATTCCAATGTTTTCGTTTATATGACGGGGCACGGTGGAAATGAATTCCTGAAGTTTCAAGACAATGAGGAGATT
AGTGCGTTTGACATTGCGGACGCGTTTGAACAGATGTATCAAAAGAAGCGTTATAATGAGATTTTCTTCATGATT
GATACCTGCCAAGCGAATACCATGTATACAAAGTTTTACTCACCCAATATTCTCGCTACCGGTTCTTCACTACTT
GGCGAAAACTCTTATTCGTATGCTAATGATAATGACCTTGGCGTGGCTGTCATCGATGCTTATACACACTATGTT
CTCCAATACATGGAGGGTATCAATAAAACGAGTCAGTTGACCATGCAAGATCTGTTCAACACTTATGATCCTGCA
AAAATCAACTCTCATCCAGGCGTGCGAAGTGACCTCTTTCAACGCCCTTTAAATACCGCCTTGATTACGGACTTT
TTCGGTGGTGTATCCCAAGTTGAGGTCGCTAGCCCTGACGATTCAGAAGACGATGAGCAAGATTTCGTCTCTCTA
TGGTAG
Transcript >AgabiH97|048680
ATGCGTTTGATCTTATTCCTTCATCTCCTTGGTATTCTATACACGACATGGGCACTCAACGCGCAACCCGTGAAC
GACTTCTTCGAACGCAATGCGGCGCCTGGAGCGTCTAAGCATACAAACAACTGGGCTGTTCTCGTCTGCGCATCG
CGGTACTGGTTCAACTATAGGCACATGGCCAACGCCCTCGGAATGTACCGAACTGTCAAGCGCCTTGGAATACCG
GATTCCAATATTATCCTTATGCTTGCGGATGACGTATCATGTAACATGCGAAACAAGTTTCCAGGAAGCGTTTAT
GCTAATCCTGGACGACATTTGGATCTATATGGTGACAATATTGAAGTGGACTACCGTGGATACGAGGTTACTGTC
GAAAACTTCATTAGACTTTTGACTGGTCGAGTGGATCCATCTGTTCCTCGTTCCAAACGCCTTTTGACCGATGAG
AATTCCAATGTTTTCGTTTATATGACGGGGCACGGTGGAAATGAATTCCTGAAGTTTCAAGACAATGAGGAGATT
AGTGCGTTTGACATTGCGGACGCGTTTGAACAGATGTATCAAAAGAAGCGTTATAATGAGATTTTCTTCATGATT
GATACCTGCCAAGCGAATACCATGTATACAAAGTTTTACTCACCCAATATTCTCGCTACCGGTTCTTCACTACTT
GGCGAAAACTCTTATTCGTATGCTAATGATAATGACCTTGGCGTGGCTGTCATCGATGCTTATACACACTATGTT
CTCCAATACATGGAGGGTATCAATAAAACGAGTCAGTTGACCATGCAAGATCTGTTCAACACTTATGATCCTGCA
AAAATCAACTCTCATCCAGGCGTGCGAAGTGACCTCTTTCAACGCCCTTTAAATACCGCCTTGATTACGGACTTT
TTCGGTGGTGTATCCCAAGTTGAGGTCGCTAGCCCTGACGATTCAGAAGACGATGAGCAAGATTTCGTCTCTCTA
TGGTAG
Gene >AgabiH97|048680
ATGCGTTTGATCTTATTCCTTCATCTCCTTGGTATTCTATACACGACATGGGCACTCAACGCGCAACCCGTGAAC
GACTTCTTCGAACGCAATGCGGCGCCTGGAGCGTCTAAGCATACAAACAACTGGGCTGTTCTCGTCTGCGCATCG
CGGTACTGGTTCAACTATAGGGTATGTGTATCACCACTTCGTGTCACGCGAAATATTCACGAAGGGTAATAGCAC
ATGGCCAACGCCCTCGGAATGTGTGTTGTCACTCCTACTCATATTGTGTCAATACTCATCTGAGACGGCGTAACA
GGTACCGAACTGTCAAGCGCCTTGGAATACCGGATTCCAATATTATCCTTATGCTTGCGGATGACGTATCATGTA
ACATGCGAAACAAGTTTCCAGGAAGCGTTTATGCTAATCCTGGACGACATTTGGATCTATATGGTGACAATATTG
AAGTGGACTACCGTGGATACGAGGTTACTGTCGAAAACTTCATTAGACTTTTGACTGGTGCGGTGTTATCTTCTT
CGGTGCACGACCACACTTAACTTACATGATTCATGTTTCTTCCCCGCAGGTCGAGTGGATCCATCTGTTCCTCGT
TCCAAACGCCTTTTGACCGATGAGAATTCCAATGTTTTCGTTTATATGACGGGGCACGGTGGAAATGAATTCCTG
AAGTTTCAAGACAATGAGGAGATTAGTGCGTTTGACATTGCGGACGCGTTTGAACAGATGTATCAAAAGAAGCGG
TGAGTCCTCTTATTTTCTCCCTCATCCTCTGTTCATTGATGCTTTTTCTTTTTTAAGTTATAATGAGATTTTCTT
CATGATTGATACCTGCCAAGCGAATACCATGTATACAAAGTTTTACTCACCCAATATTCTCGCTACCGGTTCTTC
ACTACTTGGCGAAAACTCTTATTCGGTGCGAAGTACCCTTCTCCGGAAAAAATAACCGAATCTCACACTCTCGTT
TTTCTAGTATGCTAATGATAATGACCTTGGCGTGGCTGTCATCGATGCTTATACACACTATGTTCTCCAATACAT
GGAGGGTATCAATAAAACGAGTCAGTTGACCATGCAAGATCTGGTATGTGATTTTCCTTTCTCCAGCCGTACATT
GTCCTCAATAACGCATCTCTACAGTTCAACACTTATGATCCTGCAAAAATCAACTCTCATCCAGGCGTGCGAAGT
GACCTCTTTCAACGCCCTTTAAATACCGCCTTGATTACGGACTTTTTCGGTGGTGTATCCCAAGTTGAGGTCGCT
AGCCCTGACGATTCAGAAGACGATGAGCAAGATTTCGTCTCTCTATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail