Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048470
Gene name
Locationscaffold_2:2476626..2478626
Strand-
Gene length (bp)2000
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14587 Glyco_hydr_30_2 O-Glycosyl hydrolase family 30 1.1E-28 33 341

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q76FP5|6GAL_HYPRU Endo-beta-1,6-galactanase OS=Hypocrea rufa GN=6GAL PE=1 SV=1 8 302 1.0E-08

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048470
MVALPSRIIIYTLGLLLVHVTRVTPATISSSPAQTFNGIGGSGAWWPNDLWHFPEATRQNLASLLFSQSGLGLSS
YRYNIGAGGVNVSNPTRAPETFFVRNGVYNFDADQQGRYFLNEAAKRGVSSLTAFANSAPPSLTSGGASCNGRFV
SGNGDAYGTFLADVISHFHSQGVNISLISPMNEPDSNFGPSPCGQEGMQVLPNQRAEVVNGLWNALQARGLASTV
GILADESSSLGSAVNEYSSWLPQVINKVAALVHHTYDFPSDSSYTNYVSNVRNQFPGKLSWMSEICCSLGNADGS
GKGWSGGYDPTIKNALMFSSLVFQSLVLANEPHYDFWTLVSNGLGCSPQNNPSCATSPNSNGWNDGLIYYDGNYA
RNGNFQLYIKKQFWTYKHFGNFVKPGSQRREITGSGSTKFMMAVTDSSHFYVIAMNPNGADTTLALTFPESVCAT
EAHRTSASEDFATIGKATGGGNNWSLPLRANSLSTYIFNRRAC*
Coding >AgabiH97|048470
ATGGTTGCTCTACCCAGTCGGATCATTATTTACACACTCGGTCTCCTTTTGGTTCATGTCACTCGCGTGACCCCG
GCTACTATTTCATCCAGTCCTGCTCAAACGTTCAATGGTATCGGCGGCTCCGGAGCTTGGTGGCCTAATGATCTG
TGGCATTTCCCCGAGGCAACCCGACAAAACCTGGCGTCATTGTTATTTTCCCAGAGTGGGTTAGGACTCTCTAGT
TATCGATACAACATCGGTGCTGGAGGTGTGAATGTTTCGAATCCTACCCGAGCGCCAGAGACTTTTTTTGTGCGC
AACGGAGTATACAATTTTGATGCGGACCAGCAAGGACGATACTTTTTGAACGAGGCGGCGAAACGGGGAGTTTCG
TCATTGACTGCTTTTGCGAATAGCGCACCTCCGAGTCTAACTTCGGGTGGCGCAAGTTGTAACGGACGGTTTGTT
AGCGGTAATGGAGACGCTTACGGGACCTTCCTGGCAGATGTCATTAGCCATTTCCACTCTCAAGGCGTAAACATC
AGTCTAATTTCACCAATGAATGAGCCTGACAGCAACTTTGGACCTTCGCCTTGTGGACAGGAGGGAATGCAGGTT
CTTCCTAACCAGCGAGCTGAAGTTGTCAATGGGTTGTGGAATGCGCTCCAGGCCCGAGGTTTGGCTTCGACGGTT
GGGATACTTGCCGATGAATCTTCATCCTTAGGAAGTGCAGTAAACGAGTATTCTTCTTGGTTGCCCCAAGTCATT
AACAAAGTTGCGGCACTGGTCCATCATACCTACGACTTCCCAAGCGACTCCAGTTACACGAACTACGTCTCCAAT
GTTCGAAATCAATTTCCCGGAAAACTAAGTTGGATGTCGGAAATTTGCTGCTCTCTTGGTAACGCCGATGGATCT
GGGAAAGGTTGGTCCGGAGGATATGATCCCACCATCAAAAACGCTTTAATGTTCTCCAGTCTTGTCTTCCAAAGC
CTTGTCTTGGCTAACGAACCTCATTATGATTTCTGGACTCTGGTTTCCAATGGACTTGGTTGTTCTCCACAAAAC
AACCCCTCTTGTGCCACTTCTCCCAATTCCAATGGCTGGAATGACGGTTTGATATATTACGATGGTAATTATGCA
AGGAATGGGAACTTCCAACTTTATATCAAAAAGCAATTCTGGACGTACAAGCATTTCGGCAATTTCGTGAAACCT
GGTTCACAACGACGTGAGATCACCGGTTCAGGTTCAACGAAGTTTATGATGGCAGTGACAGACTCATCCCACTTT
TATGTCATCGCCATGAACCCGAACGGCGCCGATACAACGTTGGCACTTACATTCCCAGAAAGTGTATGTGCCACG
GAAGCCCACAGAACGTCCGCAAGCGAAGATTTTGCGACGATTGGAAAGGCTACAGGGGGCGGAAACAATTGGTCT
CTTCCTTTGAGAGCGAACAGCTTGAGCACATATATATTCAACAGAAGAGCTTGCTAG
Transcript >AgabiH97|048470
ATGGTTGCTCTACCCAGTCGGATCATTATTTACACACTCGGTCTCCTTTTGGTTCATGTCACTCGCGTGACCCCG
GCTACTATTTCATCCAGTCCTGCTCAAACGTTCAATGGTATCGGCGGCTCCGGAGCTTGGTGGCCTAATGATCTG
TGGCATTTCCCCGAGGCAACCCGACAAAACCTGGCGTCATTGTTATTTTCCCAGAGTGGGTTAGGACTCTCTAGT
TATCGATACAACATCGGTGCTGGAGGTGTGAATGTTTCGAATCCTACCCGAGCGCCAGAGACTTTTTTTGTGCGC
AACGGAGTATACAATTTTGATGCGGACCAGCAAGGACGATACTTTTTGAACGAGGCGGCGAAACGGGGAGTTTCG
TCATTGACTGCTTTTGCGAATAGCGCACCTCCGAGTCTAACTTCGGGTGGCGCAAGTTGTAACGGACGGTTTGTT
AGCGGTAATGGAGACGCTTACGGGACCTTCCTGGCAGATGTCATTAGCCATTTCCACTCTCAAGGCGTAAACATC
AGTCTAATTTCACCAATGAATGAGCCTGACAGCAACTTTGGACCTTCGCCTTGTGGACAGGAGGGAATGCAGGTT
CTTCCTAACCAGCGAGCTGAAGTTGTCAATGGGTTGTGGAATGCGCTCCAGGCCCGAGGTTTGGCTTCGACGGTT
GGGATACTTGCCGATGAATCTTCATCCTTAGGAAGTGCAGTAAACGAGTATTCTTCTTGGTTGCCCCAAGTCATT
AACAAAGTTGCGGCACTGGTCCATCATACCTACGACTTCCCAAGCGACTCCAGTTACACGAACTACGTCTCCAAT
GTTCGAAATCAATTTCCCGGAAAACTAAGTTGGATGTCGGAAATTTGCTGCTCTCTTGGTAACGCCGATGGATCT
GGGAAAGGTTGGTCCGGAGGATATGATCCCACCATCAAAAACGCTTTAATGTTCTCCAGTCTTGTCTTCCAAAGC
CTTGTCTTGGCTAACGAACCTCATTATGATTTCTGGACTCTGGTTTCCAATGGACTTGGTTGTTCTCCACAAAAC
AACCCCTCTTGTGCCACTTCTCCCAATTCCAATGGCTGGAATGACGGTTTGATATATTACGATGGTAATTATGCA
AGGAATGGGAACTTCCAACTTTATATCAAAAAGCAATTCTGGACGTACAAGCATTTCGGCAATTTCGTGAAACCT
GGTTCACAACGACGTGAGATCACCGGTTCAGGTTCAACGAAGTTTATGATGGCAGTGACAGACTCATCCCACTTT
TATGTCATCGCCATGAACCCGAACGGCGCCGATACAACGTTGGCACTTACATTCCCAGAAAGTGTATGTGCCACG
GAAGCCCACAGAACGTCCGCAAGCGAAGATTTTGCGACGATTGGAAAGGCTACAGGGGGCGGAAACAATTGGTCT
CTTCCTTTGAGAGCGAACAGCTTGAGCACATATATATTCAACAGAAGAGCTTGCTAG
Gene >AgabiH97|048470
ATGGTTGCTCTACCCAGTCGGATCATTATTTACACACTCGGTCTCCTTTTGGTTCATGTCACTCGCGTGACCCCG
GCTACTATTTCATCCAGTCCTGCTCAAACGTTCAATGGTATCGGCGGCTCCGGAGCTTGGTGGCCTAATGATCTG
TGGCATTTCCCCGAGGCAACCCGACAAAACCTGGCGTCATTGTTATTTTCCCAGAGTGGGTTAGGACTCTCTAGT
TATCGATACAACATCGGTGCTGGAGGTGTGAATGTTTCGAATCCTACCCGAGCGCCAGAGACTTTTTTTGTGCGC
AACGGAGTATACAATTTTGATGCGGACCAGCAAGGACGATACTTTTTGAACGAGGCGGCGAAACGGGGAGTTTCG
TCATTGACTGCTTTTGCGAATAGCGCACCTCCGAGTCTAACTTCGGGTGGCGCAAGTTGTAACGGACGGTTTGTT
AGCGGTACGTACCTAGACGTGTTCTGGTTCTTTTCTGGTATAGGTTTCAACGACTCATGTTCGCCGGGATTTCAG
GTAATGGAGACGCTTACGGGACCTTCCTGGCAGATGTCATTAGCCATTTCCACTCTCAAGGCGTAAACATCAGTC
TAATTTCACCAATGAATGAGCCTGACAGCAACTTTGGACCTTCGCCTTGTGGACAGGAGGGAATGCAGGTTCTTC
CTAACCAGTAAGAATTGACTTTGACAAGGACTTGACAGTCGGTCATGACAAACGACATTCTTTACTAGGCGAGCT
GAAGTTGTCAATGGGTTGTGGAATGCGCTCCAGGCCCGAGGTTTGGCTTCGACGGTTGGGATACTTGCCGATGAA
TCTTCATCCTTAGGAAGTGCAGTAAACGAGTATTCTTCTTGGTTGCCCCAAGTCATTAACAAAGTTGCGGCACTG
GTCCATCATACCTACGACTTCCCAAGCGACTCCAGTTACACGAACTACGTCTCCAATGTTCGAAATCAATTTCCC
GGAAAACTAAGTTGGATGTCGGTATGTAAGATTCATTACATGCTGTTCTTGTCTCATCGACAATTTTCAAGGAAA
TTTGCTGCTCTCTTGGTAACGCCGATGGATCTGGGAAAGGTTGGTCCGGAGGATATGATCCCACGTATGCAACTT
CTTCCAGTTTGCGATGATCTAAAGCATCGACGCATGATTGCCTAGCATCAAAAACGCTTTAATGTTCTCCAGTCT
TGTCTTCCAAAGCCTTGTCTTGGCTAACGAACCTCATTATGATGTACGTGGCAACATTGACCGCTATATAAAGAC
TGAAGTAAGTTTAAACAGTTCTGGACTCTGGTTTCCAATGGTTAGTTTCTTTTTCGGTCGTTATCCTTTCAGCCT
CATTATCATCGCTACTTCACAGGACTTGGTTGTTCTCCACAAAACAACCCCTCTTGTGCCACTTCTCCCAATTCC
AATGGCTGGAATGTGAGTATACCAATCACGTCAGTTGGATATAATTATGAACTTCTCTGTCATAGGACGGTTTGA
TATATTACGATGGTAATTATGCAAGGAATGGGAACTTCCAACTTTGTACGTTTTACACTTCCTTGCTTGTCCGGT
TCATCCTAATCATTCCTTGATAGATATCAAAAAGCAATTCTGGACGTACAAGCATTTCGGCAATTTCGTGAAACG
TGAGTAATTTTATATAAATGTGCATTTTGCCTTATAAGTGCAGGCCATTAATCTGTTGACCTTCAGCTGGTTCAC
AACGACGTGAGATCACCGGTTCAGGTTCAACGAAGTTTATGATGGCAGTGACAGACTCATCCCACTTTTATGTCA
TCGCCATGAACCCGAACGGCGCCGATACAACGTTGGCACTTACATTCCCAGAAAGTGTATGTGCCACGGAAGCCC
ACAGAACGTCCGCAAGCGAAGATTTTGCGACGATTGGAAAGGCTACAGGGGGCGGAAACAATTGGTCTCTTCCTT
TGAGAGCGAACAGCTTGAGCACATATATATTCAACAGAAGAGCTTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail