Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048430
Gene name
Locationscaffold_2:2467225..2468145
Strand+
Gene length (bp)920
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 7.2E-20 32 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 27 165 2.0E-28
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 27 165 6.0E-28
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 7 160 6.0E-26
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 32 165 4.0E-24
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 27 159 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 27 165 2.0E-28
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 27 165 6.0E-28
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 7 160 6.0E-26
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 32 165 4.0E-24
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 27 159 5.0E-24
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 7 156 5.0E-24
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 32 160 2.0E-23
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 3 160 7.0E-23
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 5 160 2.0E-22
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 4 160 4.0E-22
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 32 156 4.0E-21
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 1 160 5.0E-21
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 32 160 8.0E-21
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 11 168 9.0E-21
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 21 165 1.0E-20
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 1 160 3.0E-20
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 9 168 6.0E-20
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 32 168 7.0E-20
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 13 160 8.0E-20
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 4 159 8.0E-20
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 32 160 1.0E-19
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 5 160 2.0E-19
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 29 157 2.0E-19
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 32 160 2.0E-19
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 28 160 3.0E-19
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 29 157 5.0E-18
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 35 169 2.0E-17
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 27 169 8.0E-17
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 26 165 9.0E-17
sp|B3EWZ8|ECT_ACRMI Ectin (Fragment) OS=Acropora millepora PE=1 SV=1 31 168 2.0E-16
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 27 169 5.0E-16
sp|Q9CWG1|GLIP1_MOUSE Glioma pathogenesis-related protein 1 OS=Mus musculus GN=Glipr1 PE=2 SV=1 25 156 6.0E-16
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 5 165 9.0E-16
sp|P48060|GLIP1_HUMAN Glioma pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR1 PE=1 SV=3 1 156 3.0E-15
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 3 156 9.0E-15
sp|O43692|PI15_HUMAN Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=1 SV=1 16 168 3.0E-14
sp|Q8BS03|PI15_MOUSE Peptidase inhibitor 15 OS=Mus musculus GN=Pi15 PE=2 SV=2 16 168 4.0E-14
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 23 169 6.0E-14
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 5 160 7.0E-14
sp|Q7T141|PI15A_DANRE Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 16 168 2.0E-13
sp|Q9H3Y0|CRSPL_HUMAN Peptidase inhibitor R3HDML OS=Homo sapiens GN=R3HDML PE=2 SV=1 32 168 4.0E-13
sp|Q98ST6|PI15_CHICK Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1 16 168 5.0E-13
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 28 168 2.0E-12
sp|A2A5I3|CRSPL_MOUSE Peptidase inhibitor R3HDML OS=Mus musculus GN=R3hdml PE=3 SV=1 32 168 5.0E-12
sp|Q3KPV7|PI15_XENLA Peptidase inhibitor 15 OS=Xenopus laevis GN=pi15 PE=2 SV=1 30 168 6.0E-12
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 26 168 9.0E-12
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 25 159 2.0E-11
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 29 168 2.0E-11
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 3 162 2.0E-11
sp|F8J2D4|CRVP_DRYCN Cysteine-rich venom protein OS=Drysdalia coronoides PE=1 SV=1 3 162 3.0E-11
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 3 162 3.0E-11
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 3 162 4.0E-11
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 28 168 5.0E-11
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 3 162 7.0E-11
sp|Q2XXQ3|CRVP1_PSEPL Cysteine-rich venom protein ENH1 OS=Pseudoferania polylepis PE=2 SV=1 1 159 1.0E-10
sp|Q2XXQ2|CRVP2_PSEPL Cysteine-rich venom protein ENH2 OS=Pseudoferania polylepis PE=2 SV=1 1 159 1.0E-10
sp|Q98ST5|CRLD1_CHICK Cysteine-rich secretory protein LCCL domain-containing 1 OS=Gallus gallus GN=CRISPLD1 PE=2 SV=1 20 168 1.0E-10
sp|Q7ZZN8|CRVP2_NAJAT Cysteine-rich venom protein natrin-2 OS=Naja atra PE=1 SV=1 3 162 1.0E-10
sp|P84808|CRVP2_NAJKA Cysteine-rich venom protein kaouthin-2 OS=Naja kaouthia PE=1 SV=2 3 162 1.0E-10
sp|Q7ZTA0|CRVP_AGKPI Cysteine-rich venom protein piscivorin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 3 162 2.0E-10
sp|A9YME1|VA5_MICHY Venom allergen 5 OS=Microctonus hyperodae PE=2 SV=1 32 159 2.0E-10
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 3 162 3.0E-10
sp|B0VXV6|CRVP_SISCA Cysteine-rich venom protein 2 OS=Sistrurus catenatus edwardsii PE=2 SV=1 3 162 4.0E-10
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 3 162 4.0E-10
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 24 162 5.0E-10
sp|Q8AVA3|CRVP_PSEPO Cysteine-rich venom protein pseudecin OS=Pseudechis porphyriacus PE=1 SV=1 3 162 5.0E-10
sp|Q9H336|CRLD1_HUMAN Cysteine-rich secretory protein LCCL domain-containing 1 OS=Homo sapiens GN=CRISPLD1 PE=2 SV=1 32 168 6.0E-10
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 3 162 6.0E-10
sp|Q8AVA4|CRVP_PSEAU Cysteine-rich venom protein pseudechetoxin OS=Pseudechis australis PE=1 SV=1 3 162 8.0E-10
sp|Q09566|LON1_CAEEL Protein lon-1 OS=Caenorhabditis elegans GN=lon-1 PE=1 SV=1 35 163 9.0E-10
sp|Q8JI40|CRVP_GLOBL Cysteine-rich venom protein ablomin OS=Gloydius blomhoffii PE=1 SV=1 3 162 1.0E-09
sp|B7FDI1|CRVP_VIPBE Cysteine-rich venom protein OS=Vipera berus PE=1 SV=1 3 162 1.0E-09
sp|Q8CGD2|CRLD1_MOUSE Cysteine-rich secretory protein LCCL domain-containing 1 OS=Mus musculus GN=Crispld1 PE=2 SV=1 32 168 1.0E-09
sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 OS=Homo sapiens GN=CRISP3 PE=1 SV=1 1 156 2.0E-09
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 3 162 2.0E-09
sp|P0CB15|CRIS_PROFL Serotriflin OS=Protobothrops flavoviridis PE=1 SV=1 30 162 4.0E-09
sp|D8VNS1|CRVP_CERRY Cysteine-rich venom protein OS=Cerberus rynchops PE=1 SV=1 3 159 8.0E-09
sp|Q2XXP4|CRVP_TRIBI Cysteine-rich venom protein TRI1 (Fragment) OS=Trimorphodon biscutatus PE=2 SV=1 3 162 1.0E-08
sp|Q8UW11|CRVP2_HYDHA Cysteine-rich venom protein 2 OS=Hydrophis hardwickii PE=2 SV=2 3 162 1.0E-08
sp|C0ITL3|VA5_PACCH Venom allergen 5 (Fragment) OS=Pachycondyla chinensis PE=2 SV=1 26 159 1.0E-08
sp|P79845|CRVP_PROMU Cysteine-rich venom protein OS=Protobothrops mucrosquamatus PE=2 SV=2 3 162 3.0E-08
sp|P35787|VA5_VESVI Venom allergen 5 OS=Vespula vidua PE=1 SV=1 25 160 3.0E-08
sp|P81657|VA5_VESMA Venom allergen 5 OS=Vespa mandarinia PE=1 SV=1 30 157 3.0E-08
sp|Q7ZT99|CRVP_CROAT Cysteine-rich venom protein catrin OS=Crotalus atrox PE=1 SV=1 3 162 3.0E-08
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 23 162 3.0E-08
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 30 157 3.0E-08
sp|Q7ZZN9|CRVP_PROJR Cysteine-rich venom protein OS=Protobothrops jerdonii PE=1 SV=1 3 162 4.0E-08
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 30 157 4.0E-08
sp|Q60477|CRIS2_CAVPO Cysteine-rich secretory protein 2 OS=Cavia porcellus GN=CRISP2 PE=1 SV=1 1 156 4.0E-08
sp|B2MVK7|VA5_RHYBR Venom allergen 5 OS=Rhynchium brunneum PE=2 SV=1 25 160 5.0E-08
sp|Q9CQ35|GRPL2_MOUSE GLIPR1-like protein 2 OS=Mus musculus GN=Glipr1l2 PE=1 SV=1 11 166 5.0E-08
sp|Q8JI39|CRVP_PROFL Cysteine-rich venom protein triflin OS=Protobothrops flavoviridis PE=1 SV=1 3 162 5.0E-08
sp|P84805|CRVP1_NAJKA Cysteine-rich venom protein kaouthin-1 OS=Naja kaouthia PE=1 SV=2 23 168 8.0E-08
sp|Q7T1K6|CRVP1_NAJAT Cysteine-rich venom protein natrin-1 OS=Naja atra PE=1 SV=1 23 168 9.0E-08
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 6 162 9.0E-08
sp|P35786|VA5_VESSQ Venom allergen 5 OS=Vespula squamosa PE=1 SV=1 26 160 1.0E-07
sp|Q8JGT9|CRVP_RHATT Cysteine-rich venom protein tigrin OS=Rhabdophis tigrinus tigrinus PE=1 SV=1 30 159 2.0E-07
sp|Q03401|CRIS1_MOUSE Cysteine-rich secretory protein 1 OS=Mus musculus GN=Crisp1 PE=2 SV=1 5 161 2.0E-07
sp|A1BQQ5|MR30_CONMR Cysteine-rich venom protein Mr30 OS=Conus marmoreus PE=1 SV=1 30 151 2.0E-07
sp|B7FDI0|CRVP_VIPNI Cysteine-rich venom protein (Fragment) OS=Vipera nikolskii PE=2 SV=1 23 162 2.0E-07
sp|Q2XXP5|CRVP_TELDH Cysteine-rich venom protein TEL1 (Fragment) OS=Telescopus dhara PE=2 SV=1 3 159 2.0E-07
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 30 157 3.0E-07
sp|Q91055|CRVP_HELHO Cysteine-rich venom protein helothermine OS=Heloderma horridum horridum PE=1 SV=1 22 160 3.0E-07
sp|W4VS53|CRVP_TRILK CRISP/Allergen/PR-1 OS=Trittame loki PE=1 SV=1 32 168 4.0E-07
sp|Q2XXR2|CRVP3_VARAC Cysteine-rich venom protein VAR3 (Fragment) OS=Varanus acanthurus PE=2 SV=1 1 160 4.0E-07
sp|A6MFK9|CRVP_DEMVE Cysteine-rich venom protein OS=Demansia vestigiata PE=2 SV=1 29 159 5.0E-07
sp|Q2L6Z1|VAL5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=2 SV=1 32 156 5.0E-07
sp|Q2XXQ7|CRVP8_VARAC Cysteine-rich venom protein VAR8 (Fragment) OS=Varanus acanthurus PE=2 SV=1 1 160 8.0E-07
sp|Q2XXQ0|CRVP_ERYPO Cysteine-rich venom protein LIO1 (Fragment) OS=Erythrolamprus poecilogyrus PE=2 SV=1 23 162 8.0E-07
sp|B3A0P8|SCP2_LOTGI SCP domain-containing protein 2 OS=Lottia gigantea PE=1 SV=1 34 161 8.0E-07
sp|Q4G1C9|GRPL2_HUMAN GLIPR1-like protein 2 OS=Homo sapiens GN=GLIPR1L2 PE=2 SV=2 16 167 1.0E-06
sp|O19010|CRIS3_HORSE Cysteine-rich secretory protein 3 OS=Equus caballus GN=CRISP3 PE=1 SV=1 5 156 1.0E-06
sp|Q2XXQ1|CRVP_LEIMD Cysteine-rich venom protein LEI1 (Fragment) OS=Leioheterodon madagascariensis PE=1 SV=1 1 162 1.0E-06
sp|Q2XXR0|CRVP5_VARAC Cysteine-rich venom protein VAR5 (Fragment) OS=Varanus acanthurus PE=2 SV=1 1 160 2.0E-06
sp|P10737|VA53_DOLMA Venom allergen 5.02 (Fragment) OS=Dolichovespula maculata PE=1 SV=3 19 160 2.0E-06
sp|B3A0P7|SCP1_LOTGI SCP domain-containing protein 1 OS=Lottia gigantea PE=1 SV=1 22 167 2.0E-06
sp|P35785|VA5_VESPE Venom allergen 5 OS=Vespula pensylvanica PE=1 SV=1 32 156 3.0E-06
sp|Q7YT83|TX31_CONTE Cysteine-rich venom protein OS=Conus textile PE=1 SV=1 30 168 3.0E-06
sp|P35784|VA5_VESGE Venom allergen 5 OS=Vespula germanica PE=1 SV=1 32 156 5.0E-06
sp|P35760|VA5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=1 SV=1 32 160 5.0E-06
sp|P35783|VA5_VESFL Venom allergen 5 OS=Vespula flavopilosa PE=1 SV=1 32 160 5.0E-06
sp|Q2XXQ4|CRVP3_DISTY Cysteine-rich venom protein DIS3 OS=Dispholidus typus PE=2 SV=1 30 159 8.0E-06
sp|Q8UW25|CRVP1_HYDHA Cysteine-rich venom protein 1 OS=Hydrophis hardwickii PE=2 SV=2 3 162 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048430
MKLSLAILVAIASSVSATVVNDKRDAFSDQALSVHNSYRAQYGAGALTYDKNLAAGVASYAAQCHFAHSGGNYGE
NLYATNGSGATINNAVDSWMAEAAKYDYSNPRFSEATGHFTQVVWKSSTNLGCASRQCTTGSPFGSGEWTYIICR
YTPPGNVRGQFAANVGRPR*
Coding >AgabiH97|048430
ATGAAGCTTTCCCTTGCAATTTTAGTTGCTATCGCGTCATCTGTTTCTGCGACTGTCGTCAATGATAAACGTGAT
GCATTCTCTGATCAGGCATTGAGCGTTCACAACTCTTACAGGGCACAATACGGTGCAGGAGCACTCACGTATGAT
AAAAACCTTGCCGCTGGTGTAGCAAGTTACGCGGCGCAGTGTCACTTTGCCCATAGCGGGGGAAATTATGGGGAA
AACCTTTACGCCACGAATGGGTCTGGCGCTACTATTAATAATGCTGTCGACTCGTGGATGGCCGAAGCTGCCAAA
TACGATTACAGCAATCCTCGCTTTTCTGAAGCCACTGGCCATTTCACTCAGGTTGTTTGGAAATCAAGCACTAAT
CTTGGTTGCGCTAGTCGCCAGTGCACTACGGGCAGTCCTTTCGGTTCTGGAGAGTGGACTTATATCATTTGCCGA
TACACGCCCCCTGGAAACGTCCGAGGCCAGTTCGCCGCAAATGTCGGTCGACCGCGGTAA
Transcript >AgabiH97|048430
ATGAAGCTTTCCCTTGCAATTTTAGTTGCTATCGCGTCATCTGTTTCTGCGACTGTCGTCAATGATAAACGTGAT
GCATTCTCTGATCAGGCATTGAGCGTTCACAACTCTTACAGGGCACAATACGGTGCAGGAGCACTCACGTATGAT
AAAAACCTTGCCGCTGGTGTAGCAAGTTACGCGGCGCAGTGTCACTTTGCCCATAGCGGGGGAAATTATGGGGAA
AACCTTTACGCCACGAATGGGTCTGGCGCTACTATTAATAATGCTGTCGACTCGTGGATGGCCGAAGCTGCCAAA
TACGATTACAGCAATCCTCGCTTTTCTGAAGCCACTGGCCATTTCACTCAGGTTGTTTGGAAATCAAGCACTAAT
CTTGGTTGCGCTAGTCGCCAGTGCACTACGGGCAGTCCTTTCGGTTCTGGAGAGTGGACTTATATCATTTGCCGA
TACACGCCCCCTGGAAACGTCCGAGGCCAGTTCGCCGCAAATGTCGGTCGACCGCGGTAA
Gene >AgabiH97|048430
ATGAAGCTTTCCCTTGCAATTTTAGTTGCTATCGCGTCATCTGTTTCTGCGACTGTCGTCAATGATAAACGTGGT
GAGTAACCCTGCTTGCCTGAGTTAATGATGACGTAGTGCTAACGACCATTGTTTTTTGTTATTGGCGCATAGATG
CATTCTCTGATCAGGCATTGAGCGTTCACAACTCTTACAGGGCACAATACGGTGCAGGAGCACTCACGTATGATA
AAAACCTTGCCGCTGGTGTAGCAAGTTACGCGGCGCAGTGTCACTTTGCCCATAGCGGGTGAGTATCACTCGAAA
TTTAGATTAATGCGCATATATTAAGGGACTTTTGTTCAGGGGAAATTATGGGGAAAACCTTGTGCGTGTAATGAA
TGACTGGGCGGTGCGTACAACTCATGGACTTTCGTCGATATAGTACGCCACGAATGGGTCTGGCGCTACTATTAA
TAATGCTGTCGACTCGTGGATGGCCGAAGCTGGTTGGTTCCTTTCCCCCTTAACCCCTCCGGTATGGGCTAATGA
TTTCTTATTCCTACAGCCAAATACGATTGTGCGTGTCCTCTCTACATTTCTCTGCTGTCTTGATTGAGCGAGAAA
TAGACAGCAATCCTCGCTTTTCTGAAGCCACTGGCCATTTCACTCAGGTGAGAGCCCCTTGAATTTTGATAGTAC
CAACCGTTGACAGATCTTTTACATATCTAGGTTGTTTGGAAATCAAGCACTAATCTTGGTTGCGCTAGTCGCCAG
TGCACTACGGGCAGTCCTTTCGGTTCTGGAGAGTGGACTTATATCATTTGCCGATACACGCCCCCTGGAAACGTC
CGAGGCCAGTTCGCGTACGTATATTGAAGTCTATCACAAAACCCATGATTCTAAGTCTTATCTTTCATAGCGCAA
ATGTCGGTCGACCGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail