Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048380
Gene name
Locationscaffold_2:2451611..2454479
Strand+
Gene length (bp)2868
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B093|A1864_ARTBC Secreted protein ARB_01864 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01864 PE=1 SV=1 1 622 8.0E-122
sp|Q9HDU9|YHE6_SCHPO Uncharacterized protein PB2B2.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.06c PE=3 SV=1 45 604 7.0E-105
sp|Q9US39|YFZ2_SCHPO Uncharacterized protein C1039.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.02 PE=3 SV=1 45 622 2.0E-104
sp|O13781|YEO3_SCHPO Uncharacterized protein C17G6.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.03 PE=3 SV=1 45 604 2.0E-84
sp|P38887|YH02_YEAST Uncharacterized protein YHR202W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR202W PE=1 SV=1 43 604 1.0E-78

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048380
MRLSTLTSLGLLLPLVRVYACDDHSHGGHGHGHSAPKPPLHPPTRPLEWGDINIIHTTDSHGWLLGHQKTVFPEP
NYSADLGDFASFVSHMKEIADEKRVDLILVDSGDLHDGTGITDGFPPGGVDAHDANEFVKMLPYDVMAIGNHELY
IYDNALDMHQNFAPALNGRYLTSNVNITITGDDGKPLDVPIGERFAKFKTKHGRKITSLGVLFDFTDNDKNTTVQ
KVADMVKEQWFEDAIQDEPDLFLLVGHMPVSRDNWPLVFNAVRAVHPTTPIIILGGHTHIRDCVQLDNRSMALES
GRYMETVGWMSAKLDQNKCTDAIQFSRRYLDTNRVTYEYHTRKNDNKFDTSLGEKIRNGLEALSARFNLNNIFGT
APQDYFLQSVPYPSNNSLLSLYVDDVVPTALRINNTESSQPALFILNSGSLRFDLYNGPFTVNDQFTLVPFADSF
RFISNISLSHATAAFNALNNAGISERRQETGDPAARHYDTIKGYERGDVDRIFNNWLQRMDRETDVQRRDMESLT
LGYVTNDSCPGIGDDIPHSPIPFFETPEFIASNPPTGDDITPDTLIDFVYIDFIEADFLEILNGLQTGKNFTLDD
TKQYSPLLANAVLGVYAQEKWN*
Coding >AgabiH97|048380
ATGAGACTTTCAACACTAACTTCTTTGGGTTTGCTACTCCCTTTAGTCCGTGTCTACGCCTGCGACGACCACTCT
CATGGTGGACATGGACACGGACACTCAGCACCCAAACCACCCCTCCACCCTCCTACCCGTCCACTTGAATGGGGT
GACATCAACATCATCCACACCACTGACAGTCATGGTTGGTTGTTGGGTCATCAAAAGACTGTTTTTCCAGAACCA
AATTACAGTGCTGACTTGGGAGATTTTGCATCATTTGTGTCCCATATGAAGGAAATTGCTGATGAGAAGCGCGTT
GATCTTATACTGGTTGACAGTGGTGATTTACACGATGGCACCGGCATAACTGATGGATTCCCGCCCGGTGGAGTT
GATGCTCATGATGCCAATGAGTTCGTGAAAATGCTTCCTTATGATGTGATGGCTATTGGAAACCACGAGCTATAC
ATTTACGACAATGCTCTCGACATGCATCAAAATTTTGCACCTGCATTGAATGGTCGGTACTTGACCTCCAATGTG
AACATCACTATCACAGGTGATGATGGTAAACCACTTGATGTTCCTATTGGTGAACGTTTCGCTAAGTTTAAGACT
AAACATGGGCGCAAGATAACATCACTAGGTGTTCTATTTGACTTTACAGATAACGACAAAAACACCACTGTCCAG
AAGGTAGCTGACATGGTGAAGGAACAATGGTTCGAGGATGCGATTCAGGATGAACCTGATCTGTTTTTGCTTGTA
GGACACATGCCAGTTTCTCGTGATAACTGGCCTTTAGTATTTAACGCCGTCCGTGCCGTCCATCCGACTACTCCA
ATTATCATCCTAGGAGGTCATACCCACATCCGTGATTGCGTGCAACTCGATAACAGGTCAATGGCTTTGGAAAGT
GGTCGGTACATGGAAACTGTCGGCTGGATGAGTGCCAAGCTGGACCAAAACAAATGCACAGATGCTATTCAATTC
AGCAGGAGATATCTTGATACCAACCGTGTCACATACGAGTACCATACGCGGAAGAATGACAACAAGTTTGATACG
TCGCTGGGTGAAAAAATAAGAAATGGTCTGGAAGCCCTTAGCGCTCGTTTCAACCTAAATAACATCTTCGGCACT
GCACCTCAGGACTACTTCCTGCAATCAGTCCCTTATCCATCGAATAATTCCCTCCTTTCTCTTTATGTCGATGAC
GTTGTCCCAACTGCTCTTCGAATCAACAACACTGAAAGCTCCCAGCCTGCCCTCTTTATTTTGAACTCTGGATCG
CTCCGTTTTGATCTGTACAACGGTCCGTTCACGGTCAATGACCAGTTCACACTGGTGCCATTCGCCGACTCGTTC
CGTTTCATATCGAATATATCCCTGTCGCATGCGACGGCAGCATTCAATGCCTTAAATAATGCCGGGATCAGTGAA
CGCCGCCAGGAGACTGGGGACCCAGCTGCGCGACACTACGACACGATCAAGGGATATGAGAGGGGTGATGTTGAT
CGCATTTTCAACAATTGGCTGCAAAGGATGGATCGGGAGACTGACGTTCAAAGGAGAGATATGGAAAGTCTCACG
TTGGGCTATGTCACCAACGACTCTTGCCCGGGCATCGGTGATGACATTCCCCACAGTCCGATACCCTTCTTCGAA
ACCCCCGAATTTATTGCGTCCAACCCGCCGACCGGAGACGATATTACACCCGACACTCTCATTGACTTTGTGTAT
ATTGACTTCATTGAGGCGGACTTTCTGGAGATCTTGAACGGCCTACAGACGGGTAAAAACTTTACATTGGATGAT
ACTAAACAGTACTCGCCTTTGTTGGCGAATGCTGTTTTGGGAGTTTATGCACAAGAAAAGTGGAATTAG
Transcript >AgabiH97|048380
ATGAGACTTTCAACACTAACTTCTTTGGGTTTGCTACTCCCTTTAGTCCGTGTCTACGCCTGCGACGACCACTCT
CATGGTGGACATGGACACGGACACTCAGCACCCAAACCACCCCTCCACCCTCCTACCCGTCCACTTGAATGGGGT
GACATCAACATCATCCACACCACTGACAGTCATGGTTGGTTGTTGGGTCATCAAAAGACTGTTTTTCCAGAACCA
AATTACAGTGCTGACTTGGGAGATTTTGCATCATTTGTGTCCCATATGAAGGAAATTGCTGATGAGAAGCGCGTT
GATCTTATACTGGTTGACAGTGGTGATTTACACGATGGCACCGGCATAACTGATGGATTCCCGCCCGGTGGAGTT
GATGCTCATGATGCCAATGAGTTCGTGAAAATGCTTCCTTATGATGTGATGGCTATTGGAAACCACGAGCTATAC
ATTTACGACAATGCTCTCGACATGCATCAAAATTTTGCACCTGCATTGAATGGTCGGTACTTGACCTCCAATGTG
AACATCACTATCACAGGTGATGATGGTAAACCACTTGATGTTCCTATTGGTGAACGTTTCGCTAAGTTTAAGACT
AAACATGGGCGCAAGATAACATCACTAGGTGTTCTATTTGACTTTACAGATAACGACAAAAACACCACTGTCCAG
AAGGTAGCTGACATGGTGAAGGAACAATGGTTCGAGGATGCGATTCAGGATGAACCTGATCTGTTTTTGCTTGTA
GGACACATGCCAGTTTCTCGTGATAACTGGCCTTTAGTATTTAACGCCGTCCGTGCCGTCCATCCGACTACTCCA
ATTATCATCCTAGGAGGTCATACCCACATCCGTGATTGCGTGCAACTCGATAACAGGTCAATGGCTTTGGAAAGT
GGTCGGTACATGGAAACTGTCGGCTGGATGAGTGCCAAGCTGGACCAAAACAAATGCACAGATGCTATTCAATTC
AGCAGGAGATATCTTGATACCAACCGTGTCACATACGAGTACCATACGCGGAAGAATGACAACAAGTTTGATACG
TCGCTGGGTGAAAAAATAAGAAATGGTCTGGAAGCCCTTAGCGCTCGTTTCAACCTAAATAACATCTTCGGCACT
GCACCTCAGGACTACTTCCTGCAATCAGTCCCTTATCCATCGAATAATTCCCTCCTTTCTCTTTATGTCGATGAC
GTTGTCCCAACTGCTCTTCGAATCAACAACACTGAAAGCTCCCAGCCTGCCCTCTTTATTTTGAACTCTGGATCG
CTCCGTTTTGATCTGTACAACGGTCCGTTCACGGTCAATGACCAGTTCACACTGGTGCCATTCGCCGACTCGTTC
CGTTTCATATCGAATATATCCCTGTCGCATGCGACGGCAGCATTCAATGCCTTAAATAATGCCGGGATCAGTGAA
CGCCGCCAGGAGACTGGGGACCCAGCTGCGCGACACTACGACACGATCAAGGGATATGAGAGGGGTGATGTTGAT
CGCATTTTCAACAATTGGCTGCAAAGGATGGATCGGGAGACTGACGTTCAAAGGAGAGATATGGAAAGTCTCACG
TTGGGCTATGTCACCAACGACTCTTGCCCGGGCATCGGTGATGACATTCCCCACAGTCCGATACCCTTCTTCGAA
ACCCCCGAATTTATTGCGTCCAACCCGCCGACCGGAGACGATATTACACCCGACACTCTCATTGACTTTGTGTAT
ATTGACTTCATTGAGGCGGACTTTCTGGAGATCTTGAACGGCCTACAGACGGGTAAAAACTTTACATTGGATGAT
ACTAAACAGTACTCGCCTTTGTTGGCGAATGCTGTTTTGGGAGTTTATGCACAAGAAAAGTGGAATTAG
Gene >AgabiH97|048380
ATGAGACTTTCAACACTAACTTCTTTGGGTTTGCTACTCCCTTTAGTCCGTGTCTACGCCTGCGACGACCACTCT
CATGGTGGACATGGACACGGACACTCAGCACCCAAACCACCCCTCCACCCTCCTACCCGTCCACTTGAATGGGGT
GACATCAACATCATCCACACCACTGACAGTCATGGTTGGTTGTTGGGTCATCAAAAGACTGTTTTTCCAGAACCA
AATTACAGGTGCGCTTTCGGCTTGATGTGTAAACATACAGAAGCATATACATATTTGTTAGTGCTGACTTGGGAG
ATTTTGCATCATTTGTGTCCCATATGAAGGAAATTGCTGATGTTAGTCTTGTGTACCTCTAGTGGTGTCCTTGGC
TGACCTTCATTATCAAATTCATAGGAGAAGCGCGTTGATCTTATACTGGTTGACAGTGGTGATTTACACGATGGT
AAGCCAGAATCTAGTTTTGAATTTCCTGGTAGAAAATATGACGCTCCACTACTCACAGGCACCGGCATAACTGAT
GGATTCCCGCCCGGTGGAGTTGATGCTCATGATGTGCGTATCTTGGTTTTGGAGGTATCAGTCATTAATTCCAGT
AGGCCAATGAGTTCGTGAAAATGCTTCCTTATGATGTGATGGCTATTGGAAAGTAAGTTTTGAGACTAGATTTTG
TGGCACAGTCTGGTAATTTAACTTCTTCTTTGCGATAGCCACGAGCTATACATTTACGACAATGCTCTCGACATG
TGGGTACAATATTTCGTGTGGATAGTGACTGGTGGTAATAATACTGGATAGGCATCAAAATTTTGCACCTGCATT
GAATGGTCGGTACTTGACCTCCAATGTGAACATCACTATCACAGGTGATGATGGTAAACCACTTGATGTTCCTAT
TGGTGGTACGTCCTGCTTTTTGATATCAGGGTATACTTTCATCATCTGACAATCACACAGAACGTTTCGCTAAGT
TTAAGACTAAACAGTGGGTGCAGGTCGTTTAGTTCAATTGAGGAATAGCTCAACGTATATTTCAACTTATCGCCA
TTAGTGGGCGCAAGATAACATCACTAGGTGTTCTATTTGACTTTACAGATAACGACAAAAACACCACTGTCCAGA
AGGTAGCTGACATGGTGAAGGAACAATGGGTTCGTCTTACTCGTATCACGCGTGTCAAGGGACTATATTTATTCA
TCGGCACTTCAGTTCGAGGATGCGATTCAGGATGAACCTGATCTGTTTTTGCTTGTAGGGTAAGCGTTGACCACT
TTGAGCGCGGACCACTGCCGATGTTGGCTACCTTTCAGACACATGCCAGTTTCTCGTGATAACTGTACGAGGACT
ATTCCATTTGTTGAATTTCTTGCTGAGAATTTGAATAGGGCCTTTAGTATTTAACGCCGTCCGTGCCGTCCATCC
GACTACTCCAATTATCATCCTAGGAGGTAAAGTTTCAGGTGTCGGCGACTGTTTTTTTCAAAACTGATCTATGCG
TAGGTCATACCCACATCCGTGATTGCGGTTAGTGTTGCAAAGTCCTCTCCCACACACGGGCGAACTCGCTAATGC
TTAAGACAGTGCAACTCGATAACAGGTCAATGGCTTTGGAAAGTGGTCGGTACATGGAAACTGTCGGTATGTTCC
TCATTGAAGCTCTAGCGTCGAGTCCATTCTTACACTCTTTTGAACAGGCTGGATGAGTACGTTCCCACGTTTTAT
ATCGATTGATTTTTAGAACTAGTACTCAGGTGCCAAGCTGGACCAAAACAAATGCACAGATGCTATTCAATTCAG
CAGGAGATATCTTGATACCAACCGTGTCACATACGAGGTGCGAAGATCCTTCGCGTACAGCGAAACGTGAACTCG
CCGCAGTCGATTTCAAGTACCATACGCGGAAGAATGACAACAAGTTTGATACGTCGCTGGGTGAAAAAATAAGAA
ATGGTCTGGAAGCCCTTAGCGCTCGTTTCAACCTAAATAACATCTTCGGCACTGCACCTCAGGACTACTTCCTGC
AATCGTATGTTGTCCATCACACCTCTTTGACCGTCCGTTCACTATGTTACGTGTTCAGAGTCCCTTATCCATCGA
ATAATTCCCTCCTTTCTCTTTATGTCGATGACGTTGTCCCAACTGCTCTTCGAATCAACAACACTGAAAGCTCCC
AGCCTGCCCTCTTTATTTTGAACTCTGGATCGCTCCGTTTTGATCTGTACAACGGTCCGTTCACGGTCAATGACC
AGTTCACACTGGTGCCATTCGCCGACTCGTTCCGTTTCATATCGAATATATCCCTGTCGCATGCGACGGCAGCAT
TCAATGCCTTAAATAATGCCGGGATCAGTGAACGCCGCCAGGAGACTGGGGACCCAGCTGCGCGACACTACGACA
CGATCAAGGGATATGAGAGGGGTGATGTTGATCGCATTTTCAACAATTGGCTGCAAAGGATGGATCGGGAGACTG
ACGTTCAAAGGAGAGATATGGAAAGTCTCACGTTGGGCTATGTCACCAACGACGTAAGTCTTCCTTTCTTTTTTA
TCTGCCTACCAGATGTGATTCCCTGATATTAATCATGAACTTTAGTCTTGCCCGGGCATCGGTGATGACATTCCC
CACAGTCCGATACCCTTCTTCGAAACCCCCGAATTTATTGCGTCCAACCCGCCGACCGGAGACGATATTACACCC
GACACTCTCATTGACTTTGTGTATATTGACTTCATTGAGGCGGACTTTCTGGAGATCTTGAACGGCCTACAGACG
GGTAAAAACTTTACATTGGATGATACTAAACAGTACTCGCCTTTGTTGGCGAATGCTGTTTTGGGAGTTTATGCA
CAAGAAAAGTGGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail