Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048270
Gene name
Locationscaffold_2:2423776..2424922
Strand-
Gene length (bp)1146
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.8E-49 29 283
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.6E-14 34 250
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 4.4E-09 33 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 18 281 4.0E-28
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 15 301 5.0E-24
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 31 300 1.0E-19
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 18 293 5.0E-15
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 18 281 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 18 281 4.0E-28
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 15 301 5.0E-24
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 31 300 1.0E-19
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 18 293 5.0E-15
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 18 281 6.0E-15
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 18 314 1.0E-14
sp|O34705|PLBAC_BACSU Phospholipase YtpA OS=Bacillus subtilis (strain 168) GN=ytpA PE=1 SV=1 29 283 2.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048270
MSAAYSEAWLPGPSKTQFYARTYLPSDAQPKAVVVFVHGFAEHVGRYTHFHPLIAQRGIAVFAFDQRGFGLTAQD
ETHKSKTSSYGKTSWKDQMADIAWAIEHAKEEFKGVPVLLMGHSMGGGEVLGFATQGAKSPHASAASSILAVVAT
SPLIRQAEPTSKVLKWLGSKASLFAPYTLISTPLIVDDLSHDKQANDDYMQDKLIKPMGSLRGVSDMLSNGELLL
TSSYANWPSSLPLLICHGTADKVTSFKASEEFIGKISTHTKKLIPFENGFHELQNEPDGVKERLAEDIIQFIESH
LPPIISVTEADLPPAIPFGTPEPASKL*
Coding >AgabiH97|048270
ATGTCTGCCGCATACTCAGAGGCCTGGCTGCCTGGCCCCAGCAAGACCCAGTTCTACGCCCGTACGTACCTCCCC
AGCGACGCGCAGCCCAAGGCCGTCGTCGTCTTCGTCCACGGCTTCGCAGAGCACGTCGGCAGGTACACCCACTTC
CACCCGCTCATCGCCCAGCGCGGCATCGCCGTCTTTGCCTTTGACCAGCGTGGCTTTGGCCTCACCGCCCAGGAC
GAAACACACAAAAGCAAGACTAGCTCCTATGGGAAGACCAGCTGGAAGGACCAGATGGCCGACATCGCGTGGGCC
ATCGAGCACGCCAAAGAAGAATTCAAGGGTGTGCCTGTCTTGCTGATGGGTCATTCTATGGGAGGCGGAGAGGTC
CTTGGTTTCGCCACTCAAGGCGCAAAATCCCCCCACGCATCCGCAGCGTCCTCCATCCTCGCCGTCGTCGCAACC
AGCCCGCTCATCCGCCAAGCAGAGCCCACATCAAAAGTTCTCAAATGGCTCGGTTCGAAAGCCAGTCTATTCGCC
CCCTACACACTCATTTCTACTCCTCTCATTGTCGATGACCTTTCCCATGACAAGCAGGCCAACGATGATTACATG
CAAGACAAACTCATCAAGCCCATGGGTTCGCTCAGAGGCGTCAGTGATATGCTTTCCAACGGCGAATTGCTTCTT
ACTTCGTCTTACGCCAATTGGCCGAGTTCACTTCCTCTTCTCATCTGTCATGGAACGGCAGATAAAGTGACTTCT
TTCAAAGCCTCCGAAGAGTTCATCGGCAAAATTTCCACTCATACTAAAAAACTCATTCCATTTGAGAATGGCTTC
CATGAACTCCAGAACGAACCCGACGGCGTTAAAGAGCGACTGGCAGAAGACATCATCCAGTTCATCGAGTCGCAC
CTTCCACCAATCATCAGCGTCACAGAGGCTGATCTTCCACCTGCAATCCCTTTTGGCACTCCCGAGCCCGCCTCT
AAACTGTAG
Transcript >AgabiH97|048270
ATGTCTGCCGCATACTCAGAGGCCTGGCTGCCTGGCCCCAGCAAGACCCAGTTCTACGCCCGTACGTACCTCCCC
AGCGACGCGCAGCCCAAGGCCGTCGTCGTCTTCGTCCACGGCTTCGCAGAGCACGTCGGCAGGTACACCCACTTC
CACCCGCTCATCGCCCAGCGCGGCATCGCCGTCTTTGCCTTTGACCAGCGTGGCTTTGGCCTCACCGCCCAGGAC
GAAACACACAAAAGCAAGACTAGCTCCTATGGGAAGACCAGCTGGAAGGACCAGATGGCCGACATCGCGTGGGCC
ATCGAGCACGCCAAAGAAGAATTCAAGGGTGTGCCTGTCTTGCTGATGGGTCATTCTATGGGAGGCGGAGAGGTC
CTTGGTTTCGCCACTCAAGGCGCAAAATCCCCCCACGCATCCGCAGCGTCCTCCATCCTCGCCGTCGTCGCAACC
AGCCCGCTCATCCGCCAAGCAGAGCCCACATCAAAAGTTCTCAAATGGCTCGGTTCGAAAGCCAGTCTATTCGCC
CCCTACACACTCATTTCTACTCCTCTCATTGTCGATGACCTTTCCCATGACAAGCAGGCCAACGATGATTACATG
CAAGACAAACTCATCAAGCCCATGGGTTCGCTCAGAGGCGTCAGTGATATGCTTTCCAACGGCGAATTGCTTCTT
ACTTCGTCTTACGCCAATTGGCCGAGTTCACTTCCTCTTCTCATCTGTCATGGAACGGCAGATAAAGTGACTTCT
TTCAAAGCCTCCGAAGAGTTCATCGGCAAAATTTCCACTCATACTAAAAAACTCATTCCATTTGAGAATGGCTTC
CATGAACTCCAGAACGAACCCGACGGCGTTAAAGAGCGACTGGCAGAAGACATCATCCAGTTCATCGAGTCGCAC
CTTCCACCAATCATCAGCGTCACAGAGGCTGATCTTCCACCTGCAATCCCTTTTGGCACTCCCGAGCCCGCCTCT
AAACTGTAG
Gene >AgabiH97|048270
ATGTCTGCCGCATACTCAGAGGCCTGGCTGCCTGGCCCCAGCAAGACCCAGTTCTACGCCCGTACGTACCTCCCC
AGCGACGCGCAGCCCAAGGCCGTCGTCGTCTTCGTCCACGGCTTCGCAGAGCACGTCGGCAGGTACACCCACTTC
CACCCGCTCATCGCCCAGCGCGGCATCGCCGTCTTTGCCTTTGACCAGCGTGGCTTTGGCCTCACCGCCCAGGAC
GAAACACACAAAAGCAAGACTAGCTCCTATGGGAAGACCAGCTGGAAGGACCAGATGGCCGACATCGCGTGGGCC
ATCGAGCACGCCAAAGAAGAATTCAAGGGTGTGCCTGTCTTGCTGATGGGTCATTCTATGGTAATTTTGCCCTCA
CGATGGAAACATCCCGACTGACAGTCTTCCTCGCCAGGGAGGCGGAGAGGTCCTTGGTTTCGCCACTCAAGGCGC
AAAATCCCCCCACGCATCCGCAGCGTCCTCCATCCTCGCCGTCGTCGCAACCAGCCCGCTCATCCGCCAAGCAGA
GCCCACATCAAAAGTTCTCAAATGGCTCGGTTCGAAAGCCAGTCTATTCGCCCCCTACACACTCATTTCTACTCC
TCTCATTGTCGATGTTCGTACTTTTGTCTCACGAGCTGTGCCTTGTCTCACAATGTGAAACTTGCAGGACCTTTC
CCATGACAAGCAGGCCAACGATGATTACATGCAAGACAAACTCATCAAGCCCATGGGTTCGCTCAGAGGCGTCAG
TGATATGCTTTCCAACGGCGAATTGCTTCTTACTTCGTCTTACGCCAATTGGCCGAGTTCACTTCCTGTACGTAC
AATCTTCACGTCAGACGTCACTCCTATCACTCACTAATTTTCTTCTAGCTTCTCATCTGTCATGGAACGGCAGAT
AAAGTGACTTCTTTCAAAGCCTCCGAAGAGTTCATCGGCAAAATTTCCACTCATACTAAAAAACTCATTCCATTT
GAGAATGGCTTCCATGAACTCCAGAACGAACCCGACGGCGTTAAAGAGCGACTGGCAGAAGACATCATCCAGTTC
ATCGAGTCGCACCTTCCACCAATCATCAGCGTCACAGAGGCTGATCTTCCACCTGCAATCCCTTTTGGCACTCCC
GAGCCCGCCTCTAAACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail