Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048250
Gene name
Locationscaffold_2:2417978..2419588
Strand+
Gene length (bp)1610
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 4.1E-17 268 376
PF09296 NUDIX-like NADH pyrophosphatase-like rudimentary NUDIX domain 1.4E-08 41 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q29RH3|NUD12_BOVIN Peroxisomal NADH pyrophosphatase NUDT12 OS=Bos taurus GN=NUDT12 PE=2 SV=1 12 434 3.0E-55
sp|Q9BQG2|NUD12_HUMAN Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens GN=NUDT12 PE=1 SV=1 12 434 4.0E-53
sp|Q9DCN1|NUD12_MOUSE Peroxisomal NADH pyrophosphatase NUDT12 OS=Mus musculus GN=Nudt12 PE=1 SV=1 12 435 6.0E-53
sp|Q9Y7J0|NPY1_SCHPO Probable NADH pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.03c PE=3 SV=1 13 440 7.0E-53
sp|Q4R7L8|NUD12_MACFA Peroxisomal NADH pyrophosphatase NUDT12 OS=Macaca fascicularis GN=NUDT12 PE=2 SV=1 12 434 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q29RH3|NUD12_BOVIN Peroxisomal NADH pyrophosphatase NUDT12 OS=Bos taurus GN=NUDT12 PE=2 SV=1 12 434 3.0E-55
sp|Q9BQG2|NUD12_HUMAN Peroxisomal NADH pyrophosphatase NUDT12 OS=Homo sapiens GN=NUDT12 PE=1 SV=1 12 434 4.0E-53
sp|Q9DCN1|NUD12_MOUSE Peroxisomal NADH pyrophosphatase NUDT12 OS=Mus musculus GN=Nudt12 PE=1 SV=1 12 435 6.0E-53
sp|Q9Y7J0|NPY1_SCHPO Probable NADH pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.03c PE=3 SV=1 13 440 7.0E-53
sp|Q4R7L8|NUD12_MACFA Peroxisomal NADH pyrophosphatase NUDT12 OS=Macaca fascicularis GN=NUDT12 PE=2 SV=1 12 434 2.0E-52
sp|Q5RD76|NUD12_PONAB Peroxisomal NADH pyrophosphatase NUDT12 OS=Pongo abelii GN=NUDT12 PE=2 SV=1 12 434 5.0E-52
sp|P53164|NPY1_YEAST NADH pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPY1 PE=1 SV=1 11 379 5.0E-38
sp|Q94A82|NUD19_ARATH Nudix hydrolase 19, chloroplastic OS=Arabidopsis thaliana GN=NUDT19 PE=1 SV=1 152 434 2.0E-36
sp|Q4ZTN0|NUDC_PSEU2 NADH pyrophosphatase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nudC PE=3 SV=1 185 405 2.0E-25
sp|Q48IH8|NUDC_PSE14 NADH pyrophosphatase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nudC PE=3 SV=1 185 405 4.0E-25
sp|Q882A9|NUDC_PSESM NADH pyrophosphatase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nudC PE=3 SV=1 185 405 2.0E-24
sp|Q8JZU0|NUD13_MOUSE Nucleoside diphosphate-linked moiety X motif 13 OS=Mus musculus GN=Nudt13 PE=1 SV=2 189 438 5.0E-24
sp|C1AGW8|NUDC_MYCBT NADH pyrophosphatase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=nudC PE=3 SV=1 189 388 2.0E-23
sp|A1KNJ7|NUDC_MYCBP NADH pyrophosphatase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nudC PE=3 SV=1 189 388 2.0E-23
sp|Q7TX14|NUDC_MYCBO NADH pyrophosphatase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nudC PE=3 SV=1 189 388 2.0E-23
sp|Q3KC83|NUDC_PSEPF NADH pyrophosphatase OS=Pseudomonas fluorescens (strain Pf0-1) GN=nudC PE=3 SV=1 185 374 3.0E-23
sp|Q86X67|NUD13_HUMAN Nucleoside diphosphate-linked moiety X motif 13 OS=Homo sapiens GN=NUDT13 PE=2 SV=3 187 438 4.0E-23
sp|P9WIX5|NUDC_MYCTU NADH pyrophosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nudC PE=3 SV=1 189 388 3.0E-22
sp|P9WIX4|NUDC_MYCTO NADH pyrophosphatase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nudC PE=3 SV=1 189 388 3.0E-22
sp|A5U7L9|NUDC_MYCTA NADH pyrophosphatase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nudC PE=3 SV=1 189 388 3.0E-22
sp|Q4KBL2|NUDC_PSEF5 NADH pyrophosphatase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nudC PE=3 SV=1 185 370 6.0E-22
sp|Q1IBF8|NUDC_PSEE4 NADH pyrophosphatase OS=Pseudomonas entomophila (strain L48) GN=nudC PE=3 SV=1 185 370 1.0E-21
sp|A7MJ81|NUDC_CROS8 NADH pyrophosphatase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nudC PE=3 SV=1 166 400 4.0E-21
sp|A4VLQ5|NUDC_PSEU5 NADH pyrophosphatase OS=Pseudomonas stutzeri (strain A1501) GN=nudC PE=3 SV=1 185 405 6.0E-21
sp|Q7NTZ8|NUDC_CHRVO NADH pyrophosphatase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nudC PE=3 SV=1 237 369 9.0E-21
sp|Q65W71|NUDC_MANSM NADH pyrophosphatase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nudC PE=3 SV=1 216 373 3.0E-20
sp|Q9RV62|NUDC_DEIRA NADH pyrophosphatase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nudC PE=3 SV=1 126 370 4.0E-20
sp|Q87KQ7|NUDC_VIBPA NADH pyrophosphatase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nudC PE=3 SV=1 217 374 2.0E-19
sp|Q8Z328|NUDC_SALTI NADH pyrophosphatase OS=Salmonella typhi GN=nudC PE=3 SV=1 195 374 2.0E-19
sp|Q6LLW5|NUDC_PHOPR NADH pyrophosphatase OS=Photobacterium profundum GN=nudC PE=3 SV=1 192 377 3.0E-19
sp|B4TCT5|NUDC_SALHS NADH pyrophosphatase OS=Salmonella heidelberg (strain SL476) GN=nudC PE=3 SV=1 195 374 4.0E-19
sp|A8AKS7|NUDC_CITK8 NADH pyrophosphatase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nudC PE=3 SV=1 148 374 7.0E-19
sp|B1LNU8|NUDC_ECOSM NADH pyrophosphatase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nudC PE=3 SV=1 148 374 8.0E-19
sp|B7NRS9|NUDC_ECO7I NADH pyrophosphatase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nudC PE=3 SV=1 148 374 8.0E-19
sp|Q7N961|NUDC_PHOLL NADH pyrophosphatase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nudC PE=3 SV=1 192 383 9.0E-19
sp|Q1R5W2|NUDC_ECOUT NADH pyrophosphatase OS=Escherichia coli (strain UTI89 / UPEC) GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|A1AIG7|NUDC_ECOK1 NADH pyrophosphatase OS=Escherichia coli O1:K1 / APEC GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|B7MIY2|NUDC_ECO45 NADH pyrophosphatase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|C0Q2S8|NUDC_SALPC NADH pyrophosphatase OS=Salmonella paratyphi C (strain RKS4594) GN=nudC PE=3 SV=1 195 374 1.0E-18
sp|Q57H59|NUDC_SALCH NADH pyrophosphatase OS=Salmonella choleraesuis (strain SC-B67) GN=nudC PE=3 SV=1 195 374 1.0E-18
sp|Q9L9I5|NUDC_SALTY NADH pyrophosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nudC PE=3 SV=1 195 374 1.0E-18
sp|Q8FB75|NUDC_ECOL6 NADH pyrophosphatase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|Q0TA69|NUDC_ECOL5 NADH pyrophosphatase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|B7N2J8|NUDC_ECO81 NADH pyrophosphatase OS=Escherichia coli O81 (strain ED1a) GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|B7UPF1|NUDC_ECO27 NADH pyrophosphatase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nudC PE=3 SV=1 208 374 1.0E-18
sp|B5F1H9|NUDC_SALA4 NADH pyrophosphatase OS=Salmonella agona (strain SL483) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|Q3YUY8|NUDC_SHISS NADH pyrophosphatase OS=Shigella sonnei (strain Ss046) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|B6I5K7|NUDC_ECOSE NADH pyrophosphatase OS=Escherichia coli (strain SE11) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|P32664|NUDC_ECOLI NADH pyrophosphatase OS=Escherichia coli (strain K12) GN=nudC PE=1 SV=2 148 374 2.0E-18
sp|B1IUQ1|NUDC_ECOLC NADH pyrophosphatase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|A8A796|NUDC_ECOHS NADH pyrophosphatase OS=Escherichia coli O9:H4 (strain HS) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|B1XBZ9|NUDC_ECODH NADH pyrophosphatase OS=Escherichia coli (strain K12 / DH10B) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|C5A0T7|NUDC_ECOBW NADH pyrophosphatase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|B7M7Q5|NUDC_ECO8A NADH pyrophosphatase OS=Escherichia coli O8 (strain IAI1) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|B7LA85|NUDC_ECO55 NADH pyrophosphatase OS=Escherichia coli (strain 55989 / EAEC) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|A7ZUL1|NUDC_ECO24 NADH pyrophosphatase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|B5BJR5|NUDC_SALPK NADH pyrophosphatase OS=Salmonella paratyphi A (strain AKU_12601) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|A9N0K8|NUDC_SALPB NADH pyrophosphatase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|Q5PKA4|NUDC_SALPA NADH pyrophosphatase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|B4T0Z8|NUDC_SALNS NADH pyrophosphatase OS=Salmonella newport (strain SL254) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|B5RFI8|NUDC_SALG2 NADH pyrophosphatase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|B5QYF1|NUDC_SALEP NADH pyrophosphatase OS=Salmonella enteritidis PT4 (strain P125109) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|B5FQL1|NUDC_SALDC NADH pyrophosphatase OS=Salmonella dublin (strain CT_02021853) GN=nudC PE=3 SV=1 195 374 2.0E-18
sp|C3LR63|NUDC_VIBCM NADH pyrophosphatase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nudC PE=3 SV=1 217 374 2.0E-18
sp|Q9KV27|NUDC_VIBCH NADH pyrophosphatase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nudC PE=3 SV=1 217 374 2.0E-18
sp|A5F3M9|NUDC_VIBC3 NADH pyrophosphatase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nudC PE=3 SV=1 217 374 2.0E-18
sp|A6VQT1|NUDC_ACTSZ NADH pyrophosphatase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=nudC PE=3 SV=1 172 378 2.0E-18
sp|A5UA57|NUDC_HAEIE NADH pyrophosphatase OS=Haemophilus influenzae (strain PittEE) GN=nudC PE=3 SV=1 216 378 2.0E-18
sp|Q4QNB3|NUDC_HAEI8 NADH pyrophosphatase OS=Haemophilus influenzae (strain 86-028NP) GN=nudC PE=3 SV=1 216 378 2.0E-18
sp|Q0SY04|NUDC_SHIF8 NADH pyrophosphatase OS=Shigella flexneri serotype 5b (strain 8401) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|B7NFT7|NUDC_ECOLU NADH pyrophosphatase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nudC PE=3 SV=1 148 374 2.0E-18
sp|P44710|NUDC_HAEIN NADH pyrophosphatase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nudC PE=3 SV=1 216 378 2.0E-18
sp|A5UGU3|NUDC_HAEIG NADH pyrophosphatase OS=Haemophilus influenzae (strain PittGG) GN=nudC PE=3 SV=1 216 378 2.0E-18
sp|Q31U01|NUDC_SHIBS NADH pyrophosphatase OS=Shigella boydii serotype 4 (strain Sb227) GN=nudC PE=3 SV=1 208 374 3.0E-18
sp|B2TWI3|NUDC_SHIB3 NADH pyrophosphatase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nudC PE=3 SV=1 208 374 3.0E-18
sp|B7LUK6|NUDC_ESCF3 NADH pyrophosphatase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nudC PE=3 SV=1 208 374 3.0E-18
sp|B4TQK6|NUDC_SALSV NADH pyrophosphatase OS=Salmonella schwarzengrund (strain CVM19633) GN=nudC PE=3 SV=1 195 374 3.0E-18
sp|Q19427|NPY1_CAEEL NADH pyrophosphatase OS=Caenorhabditis elegans GN=ndx-9 PE=1 SV=3 150 440 3.0E-18
sp|Q83IS3|NUDC_SHIFL NADH pyrophosphatase OS=Shigella flexneri GN=nudC PE=3 SV=1 148 374 4.0E-18
sp|Q8DD17|NUDC_VIBVU NADH pyrophosphatase OS=Vibrio vulnificus (strain CMCP6) GN=nudC PE=3 SV=1 217 374 5.0E-18
sp|A5W1F2|NUDC_PSEP1 NADH pyrophosphatase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=nudC PE=3 SV=1 155 374 6.0E-18
sp|Q32AG9|NUDC_SHIDS NADH pyrophosphatase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nudC PE=3 SV=1 208 369 6.0E-18
sp|Q88FQ8|NUDC_PSEPK NADH pyrophosphatase OS=Pseudomonas putida (strain KT2440) GN=nudC PE=3 SV=1 155 374 6.0E-18
sp|B2VG76|NUDC_ERWT9 NADH pyrophosphatase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nudC PE=3 SV=1 209 369 8.0E-18
sp|A4W5B9|NUDC_ENT38 NADH pyrophosphatase OS=Enterobacter sp. (strain 638) GN=nudC PE=3 SV=1 198 374 9.0E-18
sp|P57965|NUDC_PASMU NADH pyrophosphatase OS=Pasteurella multocida (strain Pm70) GN=nudC PE=3 SV=1 216 369 1.0E-17
sp|B0KMR5|NUDC_PSEPG NADH pyrophosphatase OS=Pseudomonas putida (strain GB-1) GN=nudC PE=3 SV=1 164 374 1.0E-17
sp|B5Z092|NUDC_ECO5E NADH pyrophosphatase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nudC PE=3 SV=1 148 374 1.0E-17
sp|Q8X6X7|NUDC_ECO57 NADH pyrophosphatase OS=Escherichia coli O157:H7 GN=nudC PE=3 SV=1 148 374 1.0E-17
sp|C6DHS8|NUDC_PECCP NADH pyrophosphatase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nudC PE=3 SV=1 195 374 4.0E-17
sp|B1J6H6|NUDC_PSEPW NADH pyrophosphatase OS=Pseudomonas putida (strain W619) GN=nudC PE=3 SV=1 185 374 5.0E-17
sp|Q02KW6|NUDC_PSEAB NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nudC PE=3 SV=1 185 370 5.0E-17
sp|B7VB54|NUDC_PSEA8 NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain LESB58) GN=nudC PE=3 SV=1 185 370 6.0E-17
sp|O86062|NUDC_PSEAE NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nudC PE=3 SV=2 185 370 6.0E-17
sp|A6TGQ3|NUDC_KLEP7 NADH pyrophosphatase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nudC PE=3 SV=1 190 374 7.0E-17
sp|Q6DAL8|NUDC_PECAS NADH pyrophosphatase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nudC PE=3 SV=1 195 374 1.0E-16
sp|B7VM66|NUDC_VIBTL NADH pyrophosphatase OS=Vibrio tasmaniensis (strain LGP32) GN=nudC PE=3 SV=1 217 369 1.0E-16
sp|B5XYE2|NUDC_KLEP3 NADH pyrophosphatase OS=Klebsiella pneumoniae (strain 342) GN=nudC PE=3 SV=1 190 369 2.0E-16
sp|A6V6Z8|NUDC_PSEA7 NADH pyrophosphatase OS=Pseudomonas aeruginosa (strain PA7) GN=nudC PE=3 SV=1 185 370 5.0E-16
sp|A1JIJ0|NUDC_YERE8 NADH pyrophosphatase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nudC PE=3 SV=1 208 374 5.0E-16
sp|B1JJK8|NUDC_YERPY NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|Q66FP3|NUDC_YERPS NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|B2K122|NUDC_YERPB NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|A7FNH4|NUDC_YERP3 NADH pyrophosphatase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|A4TS22|NUDC_YERPP NADH pyrophosphatase OS=Yersinia pestis (strain Pestoides F) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|Q1CN68|NUDC_YERPN NADH pyrophosphatase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|A9R8D3|NUDC_YERPG NADH pyrophosphatase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|Q8ZAQ5|NUDC_YERPE NADH pyrophosphatase OS=Yersinia pestis GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|Q1C1V1|NUDC_YERPA NADH pyrophosphatase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nudC PE=3 SV=1 208 374 5.0E-15
sp|C5BHE7|NUDC_EDWI9 NADH pyrophosphatase OS=Edwardsiella ictaluri (strain 93-146) GN=nudC PE=3 SV=1 208 374 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048250
MSTTDIQKPFVNMFGGSPLNRLSWLRTSHHFLNAIITLPESKWVLFNAGQPLVSSAPSSQLRLAYLSTTNVLPFL
GPQPFFGQAQEVGAIVTDQATSNVTDAARHHPQSLRISFLGMHEKNEGEGASVLPTSEFSSATSAVEALKRLGGI
PYFAMDVADLVSEGQFTEEEILKTLQKDAPDTYYWSEPRALMTGLDQFTAGVFACARSLADWNYRNKFCPGCGSK
TYSMWGGWKLSCMTLLPWAEKTDKKPCPSGKGLHNYAHPRTDSVVIMLAVDETGEKIIMGRGKRFPDKFYSALAG
FIEPGESLEDAVVREMWEEAGVRVSNLRYHSGQPWPYPANIMVGFYARADSAQPIRVDLDNELVDARWFTREEVL
AVLNHTSFRSNKELSESFGDDKGDDPKKVLAEQAAVTADEPPFKMPPATAIAGVLIRDWAEGRIKFDRIQTANL*
Coding >AgabiH97|048250
ATGAGCACTACAGATATCCAGAAGCCATTCGTGAACATGTTCGGGGGATCTCCTCTGAACAGGCTCTCCTGGCTA
CGAACTTCCCACCACTTTCTCAATGCGATTATTACTCTCCCTGAATCCAAATGGGTCCTCTTCAATGCTGGCCAA
CCTTTGGTTTCTTCTGCCCCGTCTTCTCAGCTACGACTAGCTTATTTATCCACAACCAACGTTTTGCCTTTCCTT
GGTCCTCAGCCCTTCTTTGGCCAAGCACAAGAAGTTGGCGCGATCGTCACAGATCAAGCTACGAGCAACGTAACA
GATGCTGCGAGGCATCATCCACAAAGTCTTCGCATCTCGTTCCTAGGAATGCACGAGAAGAATGAGGGTGAAGGG
GCGAGTGTCCTTCCCACATCCGAGTTCTCCTCAGCTACTTCCGCAGTGGAGGCTCTCAAGAGGTTAGGTGGTATA
CCTTATTTCGCCATGGACGTAGCAGACTTGGTTTCCGAAGGCCAATTTACAGAAGAGGAGATACTGAAGACCCTC
CAGAAAGATGCTCCGGACACCTACTATTGGTCCGAGCCGAGAGCTCTCATGACAGGGTTGGATCAGTTTACAGCT
GGCGTCTTCGCGTGCGCGAGGAGCTTGGCTGATTGGAATTATCGTAACAAATTTTGTCCAGGTTGTGGTTCTAAG
ACCTATTCAATGTGGGGCGGCTGGAAACTGTCTTGTATGACATTATTGCCTTGGGCTGAGAAGACAGACAAGAAA
CCTTGTCCATCTGGCAAGGGCCTGCACAATTATGCCCATCCACGGACGGATTCCGTAGTCATCATGCTCGCTGTC
GACGAAACGGGAGAGAAAATCATAATGGGTCGCGGTAAAAGATTCCCCGACAAATTTTATTCCGCCCTTGCGGGC
TTTATCGAACCCGGAGAATCTTTGGAAGACGCAGTCGTTCGTGAAATGTGGGAGGAAGCAGGAGTTCGTGTCTCG
AACCTTCGCTACCACTCAGGTCAACCTTGGCCGTACCCAGCGAACATCATGGTCGGCTTCTACGCCCGAGCTGAT
TCCGCGCAACCAATTAGGGTTGATCTCGATAATGAACTCGTCGATGCTCGATGGTTCACACGAGAGGAAGTTCTT
GCAGTCCTCAACCATACATCTTTCCGAAGTAATAAGGAACTCTCGGAGAGTTTTGGCGACGATAAAGGCGATGAC
CCGAAGAAGGTTCTGGCTGAACAAGCTGCGGTCACAGCGGATGAACCTCCTTTCAAGATGCCACCAGCTACAGCC
ATTGCTGGAGTGCTAATTCGAGACTGGGCGGAAGGAAGGATTAAATTCGATAGAATTCAAACAGCCAATTTGTGA
Transcript >AgabiH97|048250
ATGAGCACTACAGATATCCAGAAGCCATTCGTGAACATGTTCGGGGGATCTCCTCTGAACAGGCTCTCCTGGCTA
CGAACTTCCCACCACTTTCTCAATGCGATTATTACTCTCCCTGAATCCAAATGGGTCCTCTTCAATGCTGGCCAA
CCTTTGGTTTCTTCTGCCCCGTCTTCTCAGCTACGACTAGCTTATTTATCCACAACCAACGTTTTGCCTTTCCTT
GGTCCTCAGCCCTTCTTTGGCCAAGCACAAGAAGTTGGCGCGATCGTCACAGATCAAGCTACGAGCAACGTAACA
GATGCTGCGAGGCATCATCCACAAAGTCTTCGCATCTCGTTCCTAGGAATGCACGAGAAGAATGAGGGTGAAGGG
GCGAGTGTCCTTCCCACATCCGAGTTCTCCTCAGCTACTTCCGCAGTGGAGGCTCTCAAGAGGTTAGGTGGTATA
CCTTATTTCGCCATGGACGTAGCAGACTTGGTTTCCGAAGGCCAATTTACAGAAGAGGAGATACTGAAGACCCTC
CAGAAAGATGCTCCGGACACCTACTATTGGTCCGAGCCGAGAGCTCTCATGACAGGGTTGGATCAGTTTACAGCT
GGCGTCTTCGCGTGCGCGAGGAGCTTGGCTGATTGGAATTATCGTAACAAATTTTGTCCAGGTTGTGGTTCTAAG
ACCTATTCAATGTGGGGCGGCTGGAAACTGTCTTGTATGACATTATTGCCTTGGGCTGAGAAGACAGACAAGAAA
CCTTGTCCATCTGGCAAGGGCCTGCACAATTATGCCCATCCACGGACGGATTCCGTAGTCATCATGCTCGCTGTC
GACGAAACGGGAGAGAAAATCATAATGGGTCGCGGTAAAAGATTCCCCGACAAATTTTATTCCGCCCTTGCGGGC
TTTATCGAACCCGGAGAATCTTTGGAAGACGCAGTCGTTCGTGAAATGTGGGAGGAAGCAGGAGTTCGTGTCTCG
AACCTTCGCTACCACTCAGGTCAACCTTGGCCGTACCCAGCGAACATCATGGTCGGCTTCTACGCCCGAGCTGAT
TCCGCGCAACCAATTAGGGTTGATCTCGATAATGAACTCGTCGATGCTCGATGGTTCACACGAGAGGAAGTTCTT
GCAGTCCTCAACCATACATCTTTCCGAAGTAATAAGGAACTCTCGGAGAGTTTTGGCGACGATAAAGGCGATGAC
CCGAAGAAGGTTCTGGCTGAACAAGCTGCGGTCACAGCGGATGAACCTCCTTTCAAGATGCCACCAGCTACAGCC
ATTGCTGGAGTGCTAATTCGAGACTGGGCGGAAGGAAGGATTAAATTCGATAGAATTCAAACAGCCAATTTGTGA
Gene >AgabiH97|048250
ATGAGCACTACAGATATCCAGAAGCCGTATGTACCTCAAGATGACGGTGCCAGCTTTCCAGATCTCATTTTTCTA
TGTTCAGATTCGTGAACATGTTCGGGGGATCTCCTCTGAACAGGCTCTCCTGGCTACGAACTTCCCACCACTTTC
TCAATGCGATTATTACTCTCCCTGAATCCAAATGGGTCCTCTTCAATGCTGGCCAACCTTTGGTTTCTTCTGCCC
CGTCTTCTCAGCTACGACTAGCTTATTTATCCACAACCAACGTTTTGCCTTTCCTTGGTCCTCAGCCCTTCTTTG
GCCAAGCACAAGAAGTTGGCGCGATCGTCACAGATCAAGCTACGAGCAACGTAACAGATGCTGCGAGGCATCATC
CACAAAGTCTTCGCATCTCGTTCCTAGGAATGCACGAGAAGAATGAGGGTGAAGGGGCGAGTGTCCTTCCCACAT
CCGAGTTCTCCTCAGCTACTTCCGCAGTGGAGGCTCTCAAGAGGTTAGGTGGTATACCTTATTTCGCCATGGACG
TAGCAGACTTGGTTTCCGAAGGCCAATTTACAGAAGAGGAGATACTGAAGACCCTCCAGAAAGATGCTCCGGACA
CCTACTATTGGTCCGAGCCGAGAGCTCTCATGACAGGGTTGGATCAGTTTACAGCTGGCGTCTTCGCGTGCGCGA
GGAGCTTGGCTGATTGGAATTATCGTAACAAAGTAAGCGCGACGGTTAATTCGACATTCATGCTGGCACTTATGT
GCCTAGTTTTGTCCAGGTTGTGGTTCTAAGACCTATTCAATGTGGGGCGGCTGGAAACTGTCTTGTATGACATTA
TTGCCTTGGGCTGAGAAGACAGACAAGAAACCTTGTCCATCTGGGTAAGTCGACCATCCTCCCTCTGATGCACTT
CTCAAAATGTTTTCACAGCAAGGGCCTGCACAATTATGCCCATCCACGGACGGATTCCGTAGTCATCATGCTCGC
TGTCGACGAAACGGGAGAGAAAATCATAATGGGTCGCGGTGTGCGTACATAAATTTTTTCAGCCACATCAGGACT
CGTACTCAATTTCTTTACAGAAAAGATTCCCCGACAAATTTTATTCCGCCCTTGCGGGCTTTATCGAACCCGGAG
AATCTTTGGAAGACGCAGTCGTTCGTGAAATGTGGGAGGAAGCAGGAGTTCGTGTCTCGAACCTTCGCTACCACT
CAGGTCAACCTTGGGTACGCAGTATTTTCTGATTAAGATCAATTTTACGAAAGAGAATCTTCTAGCCGTACCCAG
CGAACATCATGGTCGGCTTCTACGCCCGAGCTGATTCCGCGCAACCAATTAGGGTTGATCTCGATAATGAACTCG
TCGATGCTCGATGGTTCACACGAGAGGAAGTTCTTGCAGTCCTCAACCATACATCTTTCCGAAGTAATAAGGAAC
TCTCGGAGAGTTTTGGCGACGATAAAGGCGATGACCCGAAGAAGGTTCTGGCTGAACAAGCTGCGGTCACAGCGG
ATGAACCTCCTTTCAAGATGCCACCAGCTACAGCCATTGCTGGAGTGCTAATTCGAGACTGGGCGGAAGGAAGGA
TTAAATTCGATAGAATTCAAACAGCCAATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail