Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|048210
Gene name
Locationscaffold_2:2406279..2410997
Strand-
Gene length (bp)4718
Transcript length (bp)3714
Coding sequence length (bp)3714
Protein length (aa) 1238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11817 Foie-gras_1 Foie gras liver health family 1 7.5E-37 331 597
PF12742 Gryzun-like Gryzun, putative Golgi trafficking 1.5E-04 1133 1176

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1RLX4|TPC11_DANRE Trafficking protein particle complex subunit 11 OS=Danio rerio GN=trappc11 PE=2 SV=1 5 1176 9.0E-40
sp|Q7Z392|TPC11_HUMAN Trafficking protein particle complex subunit 11 OS=Homo sapiens GN=TRAPPC11 PE=1 SV=2 102 1176 2.0E-38
sp|B2RXC1|TPC11_MOUSE Trafficking protein particle complex subunit 11 OS=Mus musculus GN=Trappc11 PE=1 SV=1 102 1176 3.0E-38
sp|A6QLC7|TPC11_BOVIN Trafficking protein particle complex subunit 11 OS=Bos taurus GN=TRAPPC11 PE=2 SV=1 102 1176 9.0E-38
sp|Q5ZI89|TPC11_CHICK Trafficking protein particle complex subunit 11 OS=Gallus gallus GN=TRAPPC11 PE=2 SV=1 102 1176 6.0E-36

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|048210
MNSYPPELLAQLAPVMFVAGLDVPQTQPPEPFHTLIVRLRDALTAQRKIAIWQPDKSKSFHVVLVDKEVKFPPRK
LVSPEDPQYASSHSSLSPLTPSSPLHPDGLIAPIWIRKHTTLVPSVFVMFLRLYEHPQQIPKSPLEGPDVDRERE
REAEERRWDTELSGEIANRKKANNDRNVKLTVVLLASRRMLDDPVLDARLTFIRRNSGLDSRAALFVLSPVSQSE
LGEFVKSLSQALYEPALDYYTSHSKRVRRKRNRHSTTVSSYANLPIGNIARPLRPEGWTVRYEYKMACFAEFRGE
YEVALKHYQDAYDVLVIMFGSPAILPPRTKRWAEAKVLADTINIKITKLYLYNNETSLALSHHSTHIRKFGDFSR
GWGIGEETYEFWSWTARQNRLLAELLEQATRSTLVIPVHKPQVLAADTLSNGQRIPGIDVDPRNVGLNPSHYLQH
PGYYYYAGAGCAEMRRVKFQTALEAEQNGQPTALSPGFTNEKKVDHNAIILELYTKAYELFKKYNPGDAANNGQG
RLTLLIAYRIAQTYYNSEQFEMAIRFFERIARTYRREHWGSMLRPLLTTWHSCAKQLGDVELSIRLLLEMIGHDS
PDEEYPTILEEDIVAVLESTVPKSPDTPFIVDLADAKALFNTDTVFWSPSVKVGEVAAFQISLSAPTSVSISSLP
ISSLAVYLGDENDSPAVVIRHSPEMQTEKAEPVQLIDAGCIIPREPVEVNAKLRWGVGSIIVVTGTISSDVPTVF
KVSKLVLTLELNAWKVEIPLQPCAGRYGRPSFGKWLSSINPPRFISVKRDQYSLTTVKSRSYQVEISLRHDAPAL
VDESYPIIIEIKNTDDTDLVVKVDILLQPTDADGAVNQITFEDERSSSLIKGAECGIIRPGESVSKTLELLGSGA
PGDRVLDISVQIRVPDDDDQDTQAVNVTEKLQTIIVPTLEAFKVTQDVTYQHNLTKWNTLSDLMSYDEDYEDGGR
GMEAMVITDINVAGPWPVYVEHVEFENDDARTELLDSSLETEDDDIFPGEFCSEDGFNISSRFVVPTSENESETS
SLSPGHYTIHWRRIFENGERNQHPSVTRILIPSLNPPRENVIALLDVPPIAKLHVPLELNLSIRNYHPTLSANVL
CQLETDVEDAFVASGLKSGRIPILLPGAEEKITWRLIPMECGHVQLPKLKVFNRRKLISSSSTTQAQSTVDGSSG
GGEGDVVNIVDIRRDRKSGRWIDECACPSVMNVNFLL*
Coding >AgabiH97|048210
ATGAATTCGTATCCTCCAGAGCTGCTCGCTCAGCTCGCCCCTGTAATGTTCGTCGCTGGGCTTGACGTTCCGCAG
ACTCAACCACCCGAACCCTTCCATACCCTCATTGTTAGACTGCGCGACGCTCTCACCGCTCAACGTAAAATTGCA
ATCTGGCAGCCAGACAAATCAAAGTCATTTCATGTTGTCTTGGTTGACAAGGAAGTCAAATTTCCGCCAAGGAAG
TTGGTGTCACCCGAAGACCCGCAATACGCATCGTCGCACTCATCTCTGTCACCTTTGACTCCGAGTTCACCACTA
CATCCTGATGGACTCATCGCGCCCATATGGATACGCAAACACACAACACTCGTTCCGTCGGTGTTTGTAATGTTT
CTGAGGCTGTATGAGCACCCCCAGCAAATTCCGAAATCACCGTTGGAAGGTCCTGACGTGGATAGAGAAAGAGAG
AGAGAGGCGGAAGAGAGGAGATGGGATACAGAACTTTCGGGTGAGATTGCGAACAGGAAAAAGGCAAACAACGAT
AGAAATGTCAAGTTGACGGTCGTGTTGTTGGCTAGTCGAAGAATGTTGGATGATCCAGTGTTGGATGCAAGACTG
ACGTTTATCAGGCGAAATAGTGGACTGGACTCCCGTGCAGCTCTCTTTGTGCTTAGCCCAGTAAGCCAGTCAGAA
TTAGGTGAATTCGTGAAGAGTTTGTCTCAGGCGCTCTATGAACCTGCTCTGGATTACTACACTTCGCACTCAAAA
CGGGTTCGCAGGAAACGTAATAGGCATTCGACCACTGTGTCGTCTTATGCTAATCTTCCTATCGGGAATATTGCC
AGGCCACTTCGACCGGAAGGATGGACAGTACGTTACGAGTATAAGATGGCATGCTTTGCAGAGTTTAGAGGAGAA
TATGAAGTTGCCTTGAAGCATTATCAGGATGCGTACGACGTGCTTGTAATCATGTTCGGGTCCCCTGCCATCTTG
CCTCCACGCACGAAGCGATGGGCAGAAGCCAAAGTCCTTGCAGACACCATCAATATTAAGATTACCAAACTCTAC
CTGTACAACAATGAAACCAGTCTGGCACTATCTCATCATTCGACCCACATACGGAAGTTTGGTGATTTTTCAAGA
GGGTGGGGTATAGGCGAGGAGACTTACGAATTCTGGAGCTGGACTGCCCGACAGAACCGTCTTCTTGCAGAATTG
TTGGAACAAGCAACACGATCTACTCTCGTTATTCCTGTGCATAAACCTCAAGTTCTTGCAGCCGATACCCTTTCA
AATGGACAACGAATACCTGGAATCGATGTTGATCCAAGGAATGTCGGACTCAATCCCAGCCATTATCTCCAACAT
CCGGGTTACTATTATTATGCTGGTGCGGGATGTGCGGAGATGAGGAGGGTGAAATTTCAGACTGCATTGGAGGCC
GAGCAAAATGGTCAACCAACTGCGTTATCACCTGGATTTACAAATGAAAAAAAGGTTGATCACAATGCTATTATA
TTGGAGCTCTATACGAAAGCGTACGAGCTCTTCAAGAAATACAATCCTGGTGATGCCGCCAACAATGGACAAGGT
CGTCTAACACTTTTGATCGCGTATCGTATCGCTCAGACGTATTACAACTCTGAACAGTTTGAAATGGCCATTCGA
TTCTTTGAAAGAATTGCCAGGACTTATCGCAGGGAACATTGGGGATCTATGTTAAGGCCACTGTTGACAACATGG
CATTCTTGTGCTAAACAGCTTGGAGACGTTGAATTGAGTATACGATTGCTGTTGGAAATGATAGGTCATGATTCT
CCCGATGAAGAATACCCAACGATTTTGGAAGAGGATATTGTCGCTGTCTTAGAGAGTACTGTACCGAAGTCGCCA
GATACTCCGTTTATAGTTGATCTTGCCGATGCCAAAGCCCTCTTTAATACAGATACTGTGTTCTGGTCTCCGAGC
GTCAAAGTCGGAGAAGTCGCTGCATTTCAGATTTCATTGTCTGCACCGACTTCAGTTTCGATATCTTCATTGCCG
ATTTCATCGTTGGCTGTTTACCTAGGAGACGAGAATGATTCACCGGCCGTTGTGATTCGCCATTCACCGGAAATG
CAAACCGAGAAGGCGGAGCCGGTGCAGCTGATCGATGCCGGCTGTATAATTCCTCGGGAACCTGTTGAAGTCAAC
GCAAAATTACGGTGGGGTGTTGGAAGTATTATTGTGGTCACTGGGACGATATCTTCAGATGTTCCCACTGTGTTT
AAGGTCTCGAAACTGGTCTTAACGCTTGAATTGAACGCTTGGAAGGTTGAGATTCCCTTGCAGCCCTGTGCGGGA
CGCTATGGACGACCCTCGTTTGGGAAATGGTTATCGTCTATTAACCCGCCGCGATTCATTAGCGTTAAACGTGAT
CAATATTCTTTAACGACCGTTAAATCCCGATCTTACCAAGTGGAAATCTCTCTTCGGCATGATGCACCAGCACTC
GTGGATGAAAGCTATCCCATCATTATTGAGATCAAAAATACGGACGATACGGATTTGGTCGTTAAAGTTGATATT
TTGCTACAACCTACGGATGCTGATGGGGCTGTGAATCAAATAACCTTTGAAGACGAACGATCCTCGAGTCTGATT
AAAGGTGCTGAATGTGGTATCATCAGACCTGGTGAATCCGTATCCAAAACGTTGGAGCTTCTTGGCAGTGGCGCT
CCTGGGGACAGAGTCCTTGACATCTCTGTGCAAATAAGAGTACCTGACGATGATGACCAGGATACTCAAGCCGTC
AATGTTACGGAGAAACTACAGACGATTATCGTGCCAACTTTGGAAGCCTTCAAAGTTACACAAGACGTCACATAT
CAGCATAATTTGACAAAATGGAATACCTTATCGGATTTGATGTCTTATGATGAAGATTATGAGGATGGTGGGAGG
GGAATGGAAGCAATGGTTATCACAGATATCAATGTTGCAGGGCCGTGGCCCGTCTACGTGGAACATGTCGAGTTC
GAAAATGACGATGCAAGGACGGAATTACTCGACTCTTCGCTTGAGACGGAAGATGATGACATCTTTCCAGGAGAA
TTTTGTTCTGAAGATGGATTCAACATTTCAAGCCGTTTTGTCGTTCCAACGAGTGAGAACGAATCAGAAACCAGT
TCTCTGTCGCCAGGTCATTATACAATCCATTGGAGGAGAATATTCGAGAATGGAGAGCGCAATCAACACCCTTCC
GTAACTCGAATTCTAATACCATCATTAAATCCACCCCGAGAAAACGTGATAGCCCTCTTGGATGTTCCTCCCATT
GCGAAACTTCATGTTCCTCTTGAACTCAATCTCTCCATTCGTAATTATCATCCGACATTGTCAGCGAATGTGCTT
TGTCAATTGGAGACTGACGTGGAGGACGCTTTCGTTGCCTCTGGATTAAAAAGTGGGAGAATACCAATTTTACTA
CCTGGTGCGGAAGAGAAGATTACGTGGAGGTTAATTCCCATGGAATGTGGGCATGTGCAGCTACCGAAGTTGAAG
GTATTCAACAGGAGGAAGTTGATTTCCTCTTCTTCTACTACACAAGCTCAGAGTACTGTGGATGGTTCTTCGGGA
GGTGGTGAAGGAGATGTTGTGAACATTGTCGACATTCGTCGAGATCGGAAGTCTGGAAGATGGATTGATGAGTGT
GCTTGTCCTTCCGTGATGAATGTCAATTTTTTGCTTTAG
Transcript >AgabiH97|048210
ATGAATTCGTATCCTCCAGAGCTGCTCGCTCAGCTCGCCCCTGTAATGTTCGTCGCTGGGCTTGACGTTCCGCAG
ACTCAACCACCCGAACCCTTCCATACCCTCATTGTTAGACTGCGCGACGCTCTCACCGCTCAACGTAAAATTGCA
ATCTGGCAGCCAGACAAATCAAAGTCATTTCATGTTGTCTTGGTTGACAAGGAAGTCAAATTTCCGCCAAGGAAG
TTGGTGTCACCCGAAGACCCGCAATACGCATCGTCGCACTCATCTCTGTCACCTTTGACTCCGAGTTCACCACTA
CATCCTGATGGACTCATCGCGCCCATATGGATACGCAAACACACAACACTCGTTCCGTCGGTGTTTGTAATGTTT
CTGAGGCTGTATGAGCACCCCCAGCAAATTCCGAAATCACCGTTGGAAGGTCCTGACGTGGATAGAGAAAGAGAG
AGAGAGGCGGAAGAGAGGAGATGGGATACAGAACTTTCGGGTGAGATTGCGAACAGGAAAAAGGCAAACAACGAT
AGAAATGTCAAGTTGACGGTCGTGTTGTTGGCTAGTCGAAGAATGTTGGATGATCCAGTGTTGGATGCAAGACTG
ACGTTTATCAGGCGAAATAGTGGACTGGACTCCCGTGCAGCTCTCTTTGTGCTTAGCCCAGTAAGCCAGTCAGAA
TTAGGTGAATTCGTGAAGAGTTTGTCTCAGGCGCTCTATGAACCTGCTCTGGATTACTACACTTCGCACTCAAAA
CGGGTTCGCAGGAAACGTAATAGGCATTCGACCACTGTGTCGTCTTATGCTAATCTTCCTATCGGGAATATTGCC
AGGCCACTTCGACCGGAAGGATGGACAGTACGTTACGAGTATAAGATGGCATGCTTTGCAGAGTTTAGAGGAGAA
TATGAAGTTGCCTTGAAGCATTATCAGGATGCGTACGACGTGCTTGTAATCATGTTCGGGTCCCCTGCCATCTTG
CCTCCACGCACGAAGCGATGGGCAGAAGCCAAAGTCCTTGCAGACACCATCAATATTAAGATTACCAAACTCTAC
CTGTACAACAATGAAACCAGTCTGGCACTATCTCATCATTCGACCCACATACGGAAGTTTGGTGATTTTTCAAGA
GGGTGGGGTATAGGCGAGGAGACTTACGAATTCTGGAGCTGGACTGCCCGACAGAACCGTCTTCTTGCAGAATTG
TTGGAACAAGCAACACGATCTACTCTCGTTATTCCTGTGCATAAACCTCAAGTTCTTGCAGCCGATACCCTTTCA
AATGGACAACGAATACCTGGAATCGATGTTGATCCAAGGAATGTCGGACTCAATCCCAGCCATTATCTCCAACAT
CCGGGTTACTATTATTATGCTGGTGCGGGATGTGCGGAGATGAGGAGGGTGAAATTTCAGACTGCATTGGAGGCC
GAGCAAAATGGTCAACCAACTGCGTTATCACCTGGATTTACAAATGAAAAAAAGGTTGATCACAATGCTATTATA
TTGGAGCTCTATACGAAAGCGTACGAGCTCTTCAAGAAATACAATCCTGGTGATGCCGCCAACAATGGACAAGGT
CGTCTAACACTTTTGATCGCGTATCGTATCGCTCAGACGTATTACAACTCTGAACAGTTTGAAATGGCCATTCGA
TTCTTTGAAAGAATTGCCAGGACTTATCGCAGGGAACATTGGGGATCTATGTTAAGGCCACTGTTGACAACATGG
CATTCTTGTGCTAAACAGCTTGGAGACGTTGAATTGAGTATACGATTGCTGTTGGAAATGATAGGTCATGATTCT
CCCGATGAAGAATACCCAACGATTTTGGAAGAGGATATTGTCGCTGTCTTAGAGAGTACTGTACCGAAGTCGCCA
GATACTCCGTTTATAGTTGATCTTGCCGATGCCAAAGCCCTCTTTAATACAGATACTGTGTTCTGGTCTCCGAGC
GTCAAAGTCGGAGAAGTCGCTGCATTTCAGATTTCATTGTCTGCACCGACTTCAGTTTCGATATCTTCATTGCCG
ATTTCATCGTTGGCTGTTTACCTAGGAGACGAGAATGATTCACCGGCCGTTGTGATTCGCCATTCACCGGAAATG
CAAACCGAGAAGGCGGAGCCGGTGCAGCTGATCGATGCCGGCTGTATAATTCCTCGGGAACCTGTTGAAGTCAAC
GCAAAATTACGGTGGGGTGTTGGAAGTATTATTGTGGTCACTGGGACGATATCTTCAGATGTTCCCACTGTGTTT
AAGGTCTCGAAACTGGTCTTAACGCTTGAATTGAACGCTTGGAAGGTTGAGATTCCCTTGCAGCCCTGTGCGGGA
CGCTATGGACGACCCTCGTTTGGGAAATGGTTATCGTCTATTAACCCGCCGCGATTCATTAGCGTTAAACGTGAT
CAATATTCTTTAACGACCGTTAAATCCCGATCTTACCAAGTGGAAATCTCTCTTCGGCATGATGCACCAGCACTC
GTGGATGAAAGCTATCCCATCATTATTGAGATCAAAAATACGGACGATACGGATTTGGTCGTTAAAGTTGATATT
TTGCTACAACCTACGGATGCTGATGGGGCTGTGAATCAAATAACCTTTGAAGACGAACGATCCTCGAGTCTGATT
AAAGGTGCTGAATGTGGTATCATCAGACCTGGTGAATCCGTATCCAAAACGTTGGAGCTTCTTGGCAGTGGCGCT
CCTGGGGACAGAGTCCTTGACATCTCTGTGCAAATAAGAGTACCTGACGATGATGACCAGGATACTCAAGCCGTC
AATGTTACGGAGAAACTACAGACGATTATCGTGCCAACTTTGGAAGCCTTCAAAGTTACACAAGACGTCACATAT
CAGCATAATTTGACAAAATGGAATACCTTATCGGATTTGATGTCTTATGATGAAGATTATGAGGATGGTGGGAGG
GGAATGGAAGCAATGGTTATCACAGATATCAATGTTGCAGGGCCGTGGCCCGTCTACGTGGAACATGTCGAGTTC
GAAAATGACGATGCAAGGACGGAATTACTCGACTCTTCGCTTGAGACGGAAGATGATGACATCTTTCCAGGAGAA
TTTTGTTCTGAAGATGGATTCAACATTTCAAGCCGTTTTGTCGTTCCAACGAGTGAGAACGAATCAGAAACCAGT
TCTCTGTCGCCAGGTCATTATACAATCCATTGGAGGAGAATATTCGAGAATGGAGAGCGCAATCAACACCCTTCC
GTAACTCGAATTCTAATACCATCATTAAATCCACCCCGAGAAAACGTGATAGCCCTCTTGGATGTTCCTCCCATT
GCGAAACTTCATGTTCCTCTTGAACTCAATCTCTCCATTCGTAATTATCATCCGACATTGTCAGCGAATGTGCTT
TGTCAATTGGAGACTGACGTGGAGGACGCTTTCGTTGCCTCTGGATTAAAAAGTGGGAGAATACCAATTTTACTA
CCTGGTGCGGAAGAGAAGATTACGTGGAGGTTAATTCCCATGGAATGTGGGCATGTGCAGCTACCGAAGTTGAAG
GTATTCAACAGGAGGAAGTTGATTTCCTCTTCTTCTACTACACAAGCTCAGAGTACTGTGGATGGTTCTTCGGGA
GGTGGTGAAGGAGATGTTGTGAACATTGTCGACATTCGTCGAGATCGGAAGTCTGGAAGATGGATTGATGAGTGT
GCTTGTCCTTCCGTGATGAATGTCAATTTTTTGCTTTAG
Gene >AgabiH97|048210
ATGAATTCGTATCCTCCAGAGCTGCTCGCTCAGCTCGCCCCTGTAATGTTCGTCGCTGGGCTTGACGTTCCGCAG
ACTCAACCACCCGAACCCTTCCATACCCTCATTGTTAGACTGCGCGACGCTCTCACCGCTCAACGTAAAATTGCA
ATCTGGCAGCCAGACAAATCAAAGTCATTTCATGTTGTCTTGGTTGACAAGGAAGTCAAATTTCCGCCAAGGAAG
TTGGTGTCACCCGAAGACCCGCAATACGCATCGTCGCACTCATCTCTGTCACCTTTGACTCCGAGTTCACCACTA
CATCCTGATGGACTCATCGCGCCCATATGGATACGCAAACACACAACACTCGTTCCGTCGGTGTTTGTAATGTTT
CTGAGGCTGTATGAGCACCCCCAGCAAATTCCGAAATCACCGTTGGAAGGTCCTGACGTGGATAGAGAAAGAGAG
AGAGAGGCGGAAGAGAGGAGATGGGATACAGAACTTTCGGGTGAGATTGCGAACAGGAAAAAGGCAAACAACGAT
AGAAATGTCAAGTTGACGGTCGTGTTGTTGGCTAGTCGAAGAATGTTGGGTGAGTTATGTGTTTTGTTATATGAG
CCCGTCTCAATGCGGCGTTATAGATGATCCAGTGTTGGATGCAAGACTGACGTTTATCAGGCGAAATAGTGGACT
GGACTCCCGTGCAGCTCTCTTTGTGCTTAGCCCAGTAAGCCAGTCAGAATTAGGTGAATTCGTGAAGAGGTTCGT
CCGAGCAGACTCTTCATATATTGTATCTTATCACCGCCTACAGTTTGTCTCAGGCGCTCTATGAACCTGCTCTGG
ATTACTACACTTCGCACTCAAAACGGGTTCGCAGGAAACGTAATAGGCATTCGACCACTGTGTCGTCTTATGCTA
ATCTTCCTATCGGGAATATTGCCAGGCCACTTCGACCGGAAGGATGGACAGTACGTTACGAGTATAAGATGGCAT
GCTTTGCAGAGTTTAGAGGAGAATATGAAGTTGCCTTGAAGTAAGTTTTGTTCCGTGTTTGTAGCCGGGCAGGAT
TCTGACTAAATTCCAGGCATTATCAGGATGCGTACGACGTGCTTGTAATCATGTTCGGGTCCCCTGCCATCTTGC
CTCCACGCACGAAGCGATGGGCAGAAGCCAAAGTCCTTGCAGACACCATCAATATTAAGGTAATAATGGCCGCCG
AATGTGAGGATTGTACTCAACCGCGACATGACAGATTACCAAACTCTACCTGTACAACAATGAAACCAGTCTGGC
ACTATCTCATCATTCGACCCACATACGGAAGTTTGGTGATTTTTCAAGAGGGTGGGGTATAGGCGAGGAGACTTA
CGAATTCTGGAGCTGGACTGCCCGACAGTGAGTTTAAATTGATTTCTTGATGAGATGAGGCCAAGCGCGATATTC
ATTTTCAGGAACCGTCTTCTTGCAGAATTGTTGGAACAAGCAACACGATCTACTCTCGTTATTCCTGTGCATAAA
CCTCAAGTTCTTGCAGCCGATACCCTTTCAAATGGACAACGAATACCTGGAATCGATGTTGATCCAAGGAATGTC
GGACTCAATCCCAGCCATTATCTCCAACATCCGGGTTACTATTATTATGCTGGTGCGGGATGTGCGGAGATGAGG
AGGGTGAAATTTCAGACTGCATTGGAGGCCGAGGTATCCCAACACCTTCTGAACATCATTATCACCGCAGTCAAC
TGATGTTCCACAGCAAAATGGTCAACCAACTGCGTTATCACCTGGATTTACAAATGAAAAAAAGGTTGATCACAA
TGCTATTATATTGGAGGTAATGTTTCTTGTACAGCTTGGATAGAAAGAGTCTGATCGTTCTTTCAGCTCTATACG
AAAGCGTACGAGCTCTTCAAGAAATACAATCCTGGTGATGCCGCCAACAATGGACAAGGTCGTCTAACACTTTTG
ATCGCGTATCGTATCGCTCAGACGTATTACAACTCTGAACAGTTTGAAATGGCCATTCGGTAAGTTTACACGAAT
GGATGTGCAACGGGAATATAACTGAAAGTTTTAGATAGATTCTTTGAAAGAATTGCCAGGACTTATCGCAGGGAA
CATTGGGGATCTATGTTAAGGCCACTGTTGACAACATGGCATTCTTGTGCTAAACAGCTTGGAGACGTTGAATTG
AGTATACGATTGCTGTTGGAAATGATAGGTCATGGTATGCGCTTGACCTAATACGGCAGATCTGTAAGTTGAACT
TGGTTAACCAGATTCTCCCGATGAAGAATACCCAACGATTTTGGAAGAGGATATTGTCGCTGTCTTAGAGGTATT
ACTCCTTTGTCAGTATCTTCTTCATCGTCTTGTTCATTATTGCGATAGAGTACTGTACCGAAGTCGCCAGATACT
CCGTTTATAGTTGATCTTGCCGATGCCAAAGCCCTCTGTGAGTTCAACGGTAGATAGTATAAATTCTTTATCAGC
TGACATATTTTGCTTCTAGTTAATACAGATACTGTGTTCTGGTCTCCGAGCGTCAAAGTCGGAGAAGTCGCTGCA
TTTCAGATTTCATTGTCTGCACCGACTTCAGTTTCGATATCTTCATTGCCGATTTCATCGTTGGCTGTTTACCTA
GGAGACGAGAATGATTCACCGGCCGTTGTGATTCGCCATTCACCGGAAATGCAAACCGAGAAGGCGGAGCCGGTG
CAGCTGATCGATGCCGGCTGTATAATTCCTCGGGAACCTGTTGAAGTCAACGCAAAATTACGGTGGGGTGTTGGA
AGTATTATTGTGGTCACTGGGACGATATCTTCAGATGTTCCCACTGTGTTTAAGGCATGGTTCATCTGGCCCAGA
TGACCATTCAGGCTCACTTATGTCCATACAGGTCTCGAAACTGGTCTTAACGCTTGAATTGAACGCTTGGAAGGT
TGAGATTCCCTTGCAGCCCTGTGCGGGACGCTATGGACGACCCTCGTTTGGGAAATGGTTATCGTCTATTAACCC
GCCGCGATTCATTAGCGTTAAACGTGATCAATATTCTTTAACGACGTTGGTTCTATTCAAAGTCAGACGTCTCGC
TTTCTAACCTCTTCTTTCAGCGTTAAATCCCGATCTTACCAAGTGGAAATCTCTCTTCGGCATGATGCACCAGCA
CTCGTGGATGAAAGCTATCCCATCATTATTGAGATCAAAAATACGGACGATACGGATTTGGTCGTTAAAGTTGAT
ATTTTGCTACAACCTACGGATGCTGATGGGGCTGGTAAGTGGCATACGTCACGATTGAACCAGGATTAACTTGAT
TCCATCTTAGTGAATCAAATAACCTTTGAAGACGAACGATCCTCGAGTCTGATTAAAGGTGCTGAATGTGGTATC
ATCAGACCTGGTGAATCCGTATCCAAAACGTTGGAGCTTCTTGGCAGTGGCGCTCCTGGGGACAGAGTCCTTGAC
ATCTCTGTGCAAATAAGAGTACCTGACGATGATGACCAGGATACTCAAGCCGTCAATGTTACGGAGAAACTACAG
ACGATTATCGTGCCAACTTTGGAAGCCTTCAAAGTTACACAAGACGTCACATATCAGCATAATTTGACAAAATGG
AATACCTTATCGGATTTGATGTCTTATGATGAAGATTATGAGGATGGTGGGAGGGGAATGGAAGCAATGGTTATC
ACAGATATCAATGTTGCAGGGCCGTGGCCCGTCTACGTGGAACATGTCGAGTTCGAAAATGACGTGAGTATGGGA
CTCAATTTTGACTTTTACTGGTTGTGAATGAAATCTGGCGAAGCAGGATGCAAGGACGGAATTACTCGACTCTTC
GCTTGAGACGGAAGATGATGACATCTTTCCAGGAGGTGAGCTGTCTCGTCCATATATATTTTCGAAAGCTCATTG
AGTTGCTCGTCGTAGAATTTTGTTCTGAAGATGGATTCAACATTTCAAGCCGTTTTGTCGTTCCAACGAGTGAGA
ACGAATCAGAAACCAGTTCTCTGTCGCCAGGTCATTATACAATCCATTGGAGGAGGTCTGTCGTTCCCGCCTCGT
TTGAAACTTACACATAGATTTATCTTTGCTAATATAGAATATTCGAGAATGGAGAGCGCAATCAACACCCTTCCG
TAACTCGAATTCTAATACCATCATTAAATCCACCCCGAGAAAACGTGATAGCCCTCTTGGATGTTCCTCCCATTG
CGAAACTTCATGTTCCTCTTGAACTCAATCTCTCCATTCGTAATTATCATCCGACATTGTCAGCGAATGTGCTTT
GTCAATTGGAGACTGACGTGGAGGACGCTTTCGTTGCCTCTGGATTAAAAAGTGGGAGAATACCAATTTTACTAC
CTGGTGCGGAAGAGAAGATTACGTGGAGGTTAATTCCCATGGAATGTGGGCATGTGCAGCTACCGAAGTTGAAGG
TATTCAACAGGAGGAAGTTGATTTCCTCTTCTTCTACTACACAAGCTCAGAGTACTGTGGATGGTTCTTCGGGAG
GTGGTGAAGGAGATGTTGTGAACATTGTCGACATTCGTCGAGATCGGAAGTCTGGAAGTGAGATGGACCCAAGTT
CTGGGAATGTAGGAGCGGGAGTGGGGAAGGATGGATTGATGAGTGTGCTTGTCCTTCCGTGATGAATGTCAATTT
TTTGCTTGTGAGTCTTGTTAAACATTTGTTATTTCATACCAATACGGTTACTTATTGAATGGTAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail