Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047750
Gene name
Locationscaffold_2:2294917..2297231
Strand-
Gene length (bp)2314
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14791 DNA_pol_B_thumb DNA polymerase beta thumb 4.2E-20 470 533
PF14792 DNA_pol_B_palm DNA polymerase beta palm 1.1E-17 326 463
PF14716 HHH_8 Helix-hairpin-helix domain 3.9E-10 150 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens GN=POLM PE=1 SV=1 136 534 5.0E-55
sp|Q9JIW4|DPOLM_MOUSE DNA-directed DNA/RNA polymerase mu OS=Mus musculus GN=Polm PE=1 SV=2 100 534 5.0E-51
sp|P42118|TDT_XENLA DNA nucleotidylexotransferase OS=Xenopus laevis GN=dntt PE=2 SV=1 138 534 7.0E-41
sp|Q09693|DPO4_SCHPO DNA polymerase type-X family protein pol4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol4 PE=3 SV=1 136 534 8.0E-40
sp|O57486|TDT_AMBME DNA nucleotidylexotransferase OS=Ambystoma mexicanum GN=DNTT PE=2 SV=2 138 534 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens GN=POLM PE=1 SV=1 136 534 5.0E-55
sp|Q9JIW4|DPOLM_MOUSE DNA-directed DNA/RNA polymerase mu OS=Mus musculus GN=Polm PE=1 SV=2 100 534 5.0E-51
sp|P42118|TDT_XENLA DNA nucleotidylexotransferase OS=Xenopus laevis GN=dntt PE=2 SV=1 138 534 7.0E-41
sp|Q09693|DPO4_SCHPO DNA polymerase type-X family protein pol4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol4 PE=3 SV=1 136 534 8.0E-40
sp|O57486|TDT_AMBME DNA nucleotidylexotransferase OS=Ambystoma mexicanum GN=DNTT PE=2 SV=2 138 534 5.0E-38
sp|O02789|TDT_MONDO DNA nucleotidylexotransferase OS=Monodelphis domestica GN=DNTT PE=2 SV=1 118 534 4.0E-37
sp|P04053|TDT_HUMAN DNA nucleotidylexotransferase OS=Homo sapiens GN=DNTT PE=1 SV=3 97 534 3.0E-36
sp|P09838|TDT_MOUSE DNA nucleotidylexotransferase OS=Mus musculus GN=Dntt PE=1 SV=3 138 534 1.0E-35
sp|A4PCD4|TDT_EULMA DNA nucleotidylexotransferase OS=Eulemur macaco GN=DNTT PE=3 SV=1 138 534 1.0E-33
sp|Q92089|TDT_ONCMY DNA nucleotidylexotransferase OS=Oncorhynchus mykiss GN=dntt PE=2 SV=1 102 534 3.0E-33
sp|P06526|TDT_BOVIN DNA nucleotidylexotransferase OS=Bos taurus GN=DNTT PE=1 SV=2 138 534 4.0E-33
sp|P36195|TDT_CHICK DNA nucleotidylexotransferase OS=Gallus gallus GN=DNTT PE=2 SV=1 138 534 5.0E-31
sp|Q6DRD3|DPOLB_DANRE DNA polymerase beta OS=Danio rerio GN=polb PE=2 SV=2 175 533 6.0E-29
sp|Q27958|DPOLB_BOVIN DNA polymerase beta OS=Bos taurus GN=POLB PE=2 SV=3 175 533 2.0E-28
sp|Q8K409|DPOLB_MOUSE DNA polymerase beta OS=Mus musculus GN=Polb PE=1 SV=3 175 533 2.0E-28
sp|P06766|DPOLB_RAT DNA polymerase beta OS=Rattus norvegicus GN=Polb PE=1 SV=4 175 533 3.0E-28
sp|Q9UGP5|DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens GN=POLL PE=1 SV=1 138 533 5.0E-28
sp|Q4R380|DPOLL_MACFA DNA polymerase lambda OS=Macaca fascicularis GN=POLL PE=2 SV=1 138 533 3.0E-27
sp|P06746|DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens GN=POLB PE=1 SV=3 175 533 7.0E-27
sp|O57383|DPOLB_XENLA DNA polymerase beta OS=Xenopus laevis GN=polb PE=1 SV=3 175 533 8.0E-26
sp|Q5RKI3|DPOLL_RAT DNA polymerase lambda OS=Rattus norvegicus GN=Poll PE=2 SV=1 138 533 9.0E-25
sp|Q9QXE2|DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus GN=Poll PE=2 SV=1 138 533 4.0E-24
sp|Q7T6Y4|DPOLX_MIMIV Probable DNA polymerase family X OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L318 PE=1 SV=2 177 532 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047750
MLGKRPRTPSSSPSDGPSKRQRSDSLDSWDGFSNQRLRVYVVQAKLDEKEIADIYRLVESHASGLHLQLSSSPET
ADIIITVVHMLKRLERHVPWDVAKQKSIVTPEWLRQSIKLKRPAPCGGFAAIRQLHNDTNPWYACARAHPLICPN
QALAIALNVLGRSRELEGLSVNALAYERAVAIIKSYPSVITRDNFRQEISKLPGVGSKVRSKIEEFINNGTIEET
ETTLESERYRSLSLFNTVYGIGPSAARHLYELGLRSVGDLERYYDVPQGANASQLDDIESQTFTPNGRPVPLKSF
TEGNAKIPPISVKVALALREDLNTPIPRAELEEIHRVIMSELEQVQAGCTSTVVGGHRRGKLESNDMDIVITHSD
MHQGTGSIKGMAAKLVERLYKRGLVTHVMHLSGFHSHNPLRTEHWDSLEKALTVFRLPASSTASQSQSSEAGSQT
RRLYRRLDLIFAPPEAYWTAVVGWSGSRLFERDLRLWAKVEKGMKFDSSGLTRRHDSKLFVPENEEDVFKILGLE
WVDPTLRNANV*
Coding >AgabiH97|047750
ATGCTCGGTAAGCGTCCGCGCACCCCGAGTTCTTCGCCTTCAGACGGGCCATCCAAACGGCAGCGCTCCGACTCC
CTCGACAGCTGGGACGGCTTTTCAAACCAGCGACTGAGGGTCTACGTCGTCCAGGCAAAACTGGATGAGAAAGAA
ATTGCCGATATATACCGTCTTGTAGAGTCACATGCTAGCGGTCTCCATCTACAGCTCTCAAGCAGTCCAGAGACA
GCAGATATCATAATCACAGTCGTTCACATGCTCAAACGTCTCGAACGGCACGTTCCATGGGACGTCGCTAAACAA
AAATCCATCGTCACTCCCGAATGGCTCCGCCAGTCTATCAAATTAAAGCGTCCTGCCCCTTGCGGTGGCTTTGCC
GCCATCAGACAATTGCATAACGATACCAATCCGTGGTATGCGTGTGCGCGTGCTCATCCATTAATTTGTCCAAAC
CAAGCACTTGCAATTGCACTGAATGTCCTTGGGCGTTCTCGAGAGTTGGAGGGGCTCTCTGTCAATGCCCTCGCC
TACGAACGTGCTGTTGCTATCATCAAATCATATCCGTCCGTCATCACGCGAGACAACTTTCGGCAAGAAATCTCT
AAGCTACCAGGCGTTGGATCCAAAGTCCGCTCAAAGATCGAAGAATTCATCAACAATGGAACGATTGAAGAAACA
GAGACTACCTTGGAATCAGAACGTTACCGCTCTCTCTCGCTGTTTAATACAGTTTATGGTATCGGACCATCCGCT
GCTCGCCATTTATACGAACTTGGTCTTCGGTCTGTAGGAGATCTGGAAAGATACTACGACGTCCCGCAAGGAGCC
AATGCCTCTCAACTAGACGATATCGAGTCACAAACATTTACGCCTAACGGACGGCCAGTACCTTTAAAGAGCTTT
ACAGAAGGAAATGCGAAAATTCCGCCCATTTCAGTCAAAGTTGCGTTAGCTCTCAGAGAAGATTTGAACACCCCA
ATTCCAAGAGCGGAGCTTGAAGAAATACATAGAGTAATCATGAGCGAGCTAGAACAAGTTCAAGCGGGATGTACC
AGCACGGTTGTCGGAGGGCACAGGAGAGGAAAACTTGAGAGCAATGACATGGATATTGTTATCACCCATTCGGAT
ATGCATCAAGGCACAGGGTCCATCAAAGGAATGGCGGCAAAACTGGTCGAGAGATTGTATAAACGCGGTTTGGTA
ACTCATGTCATGCACTTATCCGGGTTTCATTCACACAATCCACTTCGCACGGAACACTGGGACTCGCTAGAAAAG
GCCTTAACCGTGTTCCGACTACCCGCTTCATCAACAGCTTCGCAGTCACAATCTTCTGAAGCGGGTTCACAGACT
CGAAGATTGTATCGTCGTCTCGACTTGATCTTTGCTCCTCCGGAAGCCTATTGGACCGCTGTAGTCGGGTGGAGT
GGATCGAGGCTATTTGAACGTGATTTGAGACTTTGGGCTAAAGTCGAAAAAGGGATGAAATTTGACAGTTCCGGA
TTGACAAGGAGACATGATTCTAAATTATTTGTGCCCGAGAACGAAGAAGACGTGTTTAAGATACTTGGGTTAGAG
TGGGTCGATCCTACTTTGCGTAATGCGAATGTTTAA
Transcript >AgabiH97|047750
ATGCTCGGTAAGCGTCCGCGCACCCCGAGTTCTTCGCCTTCAGACGGGCCATCCAAACGGCAGCGCTCCGACTCC
CTCGACAGCTGGGACGGCTTTTCAAACCAGCGACTGAGGGTCTACGTCGTCCAGGCAAAACTGGATGAGAAAGAA
ATTGCCGATATATACCGTCTTGTAGAGTCACATGCTAGCGGTCTCCATCTACAGCTCTCAAGCAGTCCAGAGACA
GCAGATATCATAATCACAGTCGTTCACATGCTCAAACGTCTCGAACGGCACGTTCCATGGGACGTCGCTAAACAA
AAATCCATCGTCACTCCCGAATGGCTCCGCCAGTCTATCAAATTAAAGCGTCCTGCCCCTTGCGGTGGCTTTGCC
GCCATCAGACAATTGCATAACGATACCAATCCGTGGTATGCGTGTGCGCGTGCTCATCCATTAATTTGTCCAAAC
CAAGCACTTGCAATTGCACTGAATGTCCTTGGGCGTTCTCGAGAGTTGGAGGGGCTCTCTGTCAATGCCCTCGCC
TACGAACGTGCTGTTGCTATCATCAAATCATATCCGTCCGTCATCACGCGAGACAACTTTCGGCAAGAAATCTCT
AAGCTACCAGGCGTTGGATCCAAAGTCCGCTCAAAGATCGAAGAATTCATCAACAATGGAACGATTGAAGAAACA
GAGACTACCTTGGAATCAGAACGTTACCGCTCTCTCTCGCTGTTTAATACAGTTTATGGTATCGGACCATCCGCT
GCTCGCCATTTATACGAACTTGGTCTTCGGTCTGTAGGAGATCTGGAAAGATACTACGACGTCCCGCAAGGAGCC
AATGCCTCTCAACTAGACGATATCGAGTCACAAACATTTACGCCTAACGGACGGCCAGTACCTTTAAAGAGCTTT
ACAGAAGGAAATGCGAAAATTCCGCCCATTTCAGTCAAAGTTGCGTTAGCTCTCAGAGAAGATTTGAACACCCCA
ATTCCAAGAGCGGAGCTTGAAGAAATACATAGAGTAATCATGAGCGAGCTAGAACAAGTTCAAGCGGGATGTACC
AGCACGGTTGTCGGAGGGCACAGGAGAGGAAAACTTGAGAGCAATGACATGGATATTGTTATCACCCATTCGGAT
ATGCATCAAGGCACAGGGTCCATCAAAGGAATGGCGGCAAAACTGGTCGAGAGATTGTATAAACGCGGTTTGGTA
ACTCATGTCATGCACTTATCCGGGTTTCATTCACACAATCCACTTCGCACGGAACACTGGGACTCGCTAGAAAAG
GCCTTAACCGTGTTCCGACTACCCGCTTCATCAACAGCTTCGCAGTCACAATCTTCTGAAGCGGGTTCACAGACT
CGAAGATTGTATCGTCGTCTCGACTTGATCTTTGCTCCTCCGGAAGCCTATTGGACCGCTGTAGTCGGGTGGAGT
GGATCGAGGCTATTTGAACGTGATTTGAGACTTTGGGCTAAAGTCGAAAAAGGGATGAAATTTGACAGTTCCGGA
TTGACAAGGAGACATGATTCTAAATTATTTGTGCCCGAGAACGAAGAAGACGTGTTTAAGATACTTGGGTTAGAG
TGGGTCGATCCTACTTTGCGTAATGCGAATGTTTAA
Gene >AgabiH97|047750
ATGCTCGGTAAGCGTCCGCGCACCCCGAGTTCTTCGCCTTCAGACGGGCCATCCAAACGGCAGCGCTCCGACTCC
CTCGACAGCTGGGACGGCTTTTCAAACCAGCGACTGAGGGTCTACGTCGTCCAGGCAAAACTGGATGAGAAAGAA
ATTGCCGATATATACCGTCTTGTAGAGTCACATGCTAGCGGTCTCCATCTACAGCTCTCAAGCAGTCCAGAGACA
GCAGATATCATAATCACAGTCGTTCACATGCTCAAACGTCTCGAACGGCACGTTCCATGGGACGTCGCTGTATGT
ATGGCGTCATAACACCCTACCATAACCCCGCTCGTTGACTAGACTCCAACAGAAACAAAAATCCATCGTCACTCC
CGAATGGCTCCGCCAGTCTATCAAATTAAAGCGTCCTGCCCCTTGCGGTGGCTTTGCCGCCATCAGACAATTGCA
TAACGATACCGTGGAGCATTGCCCGGAACAGGACGAAAGCTCCGAGCCATCACAAAACACTGCTCATCCGATGGC
TTCTGCAGAATCCGTGGTAGTTTTCAAACCGACGAGTGAAAAAGTCAAGAATAACTGGAGATCCAGGTATGCGTG
TGCGCGTGCTCATCCATTAATTTGTCCAAACCAAGCACTTGCAATTGCACTGAATGTCCTTGGGCGTTCTCGAGA
GTTGGAGGGGCTCTCTGTCAATGCCCTCGCCTACGAACGTGCTGTTGCTGTGAGTGTTTGACGACAGGATGTACG
AAGCCGCTACTTAGTTAAATCACCAGATCATCAAATGTGAGCCAACATAGTAAATGGGTCTGTCACGGCTATTAA
ACACTGCTCAGCATATCCGTCCGTCATCACGCGAGACAACTTTCGGCAAGAAATCTCTAAGCTACCAGGCGTTGG
ATCCAAAGTCCGCTCAAAGGTACGAATGCACTTGGTGGCAGATGTCTTAGTCTAATATGCGGTAGATCGAAGAAT
TCATCAACAATGGAACGATTGAAGAAACAGGTAAGACTGACTTCCCCAAGTTCATGAATTTAGGCCGACTCTGTT
ATGTCAGAGACTACCTTGGAATCAGAACGTTACCGCTCTCTCTCGCTGTTTAATACAGTTTATGGTATCGGACCA
TCCGCTGCTCGCCATTTATACGAACTTGGTCTTCGGTCTGTAGGAGATCTGGAAAGATACTACGACGTCCCGCAA
GGAGCCAATGCCTCTCAACTAGACGATATCGAGTCACAAACATTTACGCCTAACGGACGGCCAGTACCTTTAAAG
AGCTTTACAGAAGGAAATGCGAAAATTCCGCCCATTTCAGTCAAAGTTGCGTTAGCTCTCAGAGAAGATTTGAAC
ACCCCAATTCCAAGAGCGGAGCTTGAAGAAATACATAGAGTAATCATGAGCGAGCTAGAACAAGTTCAAGCGGGA
TGTACCAGCACGGTTGTCGGAGGGTCCGCTTATCAACTTCGAAAGATACATCAAATACTCATATATCTACAGGCA
CAGGAGAGGAAAACTTGAGAGCAATGACATGGATATTGTTATCACCCATTCGGATATGCATCAAGGCACAGGGTC
CATCAAAGGAATGGCGGCAAAACTGGTCGAGAGATTGTATAAACGCGGTGAGCTGATTCATGCTTTGCATGTTCA
AGTTTCTAACTACTCTCAAGGTTTGGTAACTCATGTCATGCGTACGTAGTTGAAATTTGCGCAAGACTAATTGAC
CTTTTGAGGTTTCATCAATTTAGACTTATCCGGGTTTCATTCACACAATCCACTTCGCACGGAACACTGGGACTC
GCTAGAAAAGGCCTTAACCGTGTTCCGACTACCCGCTTCATCAACAGCTTCGCAGTCACAATCTTCTGAAGCGGG
TTCACAGACTCGAAGATTGTATCGTCGTCTCGACTTGATCTTTGCTCCTCCGGAAGCCTATTGGACCGCTGTAGT
CGGGTGGTAATTACCGTTTTGCTTTTTCATCAATCTTACCTTTTGACTTATGGTTTATGATCAGGAGTGGATCGA
GGCTATTTGAACGTGATTTGAGACTTTGGGCTAAAGTCGAAAAGTACGTTTTTCAAAACCGATGATATGTGTACC
TAAATTTATGTCTGTCCAGAGGGATGAAATTTGACAGTTCCGGATTGTACGTTTACTTTTTTTTTCTTGAGATAG
TACTAATCTTGGTCCTGACGTGCGATTTAGGACAAGGAGACATGATTCTAAATTATTTGTGCCCGAGAACGAAGA
AGACGTGTTTAAGATACTTGGGTTAGAGTGGGTCGATCCTACTTTGCGTAATGCGAATGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail