Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047690
Gene name
Locationscaffold_2:2278918..2281071
Strand+
Gene length (bp)2153
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.3E-02 397 414
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 9.4E-05 475 492
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.6E-02 504 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 397 494 9.0E-15
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 396 537 2.0E-13
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 12 87 2.0E-08
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 380 537 3.0E-07
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 390 521 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 397 494 9.0E-15
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 396 537 2.0E-13
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 12 87 2.0E-08
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 380 537 3.0E-07
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 390 521 5.0E-07
sp|Q8BJ05|ZC3HE_MOUSE Zinc finger CCCH domain-containing protein 14 OS=Mus musculus GN=Zc3h14 PE=1 SV=1 380 538 3.0E-06
sp|Q08AZ1|ZC3HE_XENLA Zinc finger CCCH domain-containing protein 14 OS=Xenopus laevis GN=zc3h14 PE=2 SV=2 398 521 3.0E-06
sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus GN=Zc3h14 PE=1 SV=1 380 536 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4896 0.8912 0.1256 0.0143 0.0924 0.0018 0.0149 0.0054 0.0073 0.0056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 68.47 41.06 95.88
Initials Initials knots 51.14 30.69 71.58
Pileal_Stipeal_center Stage I stipe center 75.95 45.47 106.43
Pileal_Stipeal_shell Stage I stipe shell 105.81 62.61 149.02
DIF_stipe_center Stage II stipe center 83.44 50.06 116.82
DIF_stipe_shell Stage II stipe shell 73.29 44.09 102.49
DIF_stipe_skin Stage II stipe skin 71.45 42.99 99.91
DIF_cap_skin Stage II cap skin 130.67 76.70 184.64
DIF_cap_tissue Stage II cap tissue 128.05 75.32 180.77
DIF_gill_tissue Stage II gill tissue 106.48 63.31 149.66
YFB_stipe_center Young fruiting body stipe center 75.39 45.21 105.56
YFB_stipe_shell Young fruiting body stipe shell 68.88 41.43 96.34
YFB_stipe_skin Young fruiting body stipe skin 66.50 40.03 92.97
YFB_cap_skin Young fruiting body cap skin 105.55 62.79 148.32
YFB_cap_tissue Young fruiting body cap tissue 95.80 57.18 134.42
YFB_gill_tissue Young fruiting body gill tissue 94.24 56.20 132.28
YFB_veil Young fruiting body veil 95.05 55.71 134.38

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.122169 no
Casing YFB_stipe_center 0.839990 no
Casing YFB_stipe_shell 0.989847 no
Casing YFB_stipe_skin 0.957777 no
Casing YFB_cap_skin 0.130393 no
Casing YFB_cap_tissue 0.282407 no
Casing YFB_gill_tissue 0.317425 no
Casing YFB_veil 0.305427 no
Casing Initials 0.370110 no
Casing Pileal_Stipeal_center 0.823983 no
Casing Pileal_Stipeal_shell 0.132709 no
Casing DIF_stipe_center 0.597035 no
Casing DIF_stipe_shell 0.890970 no
Casing DIF_stipe_skin 0.937818 no
Casing DIF_cap_skin 0.011350 yes
Casing DIF_cap_tissue 0.013782 yes
DIF_gill_tissue YFB_stipe_center 0.247691 no
DIF_gill_tissue YFB_stipe_shell 0.116571 no
DIF_gill_tissue YFB_stipe_skin 0.078944 no
DIF_gill_tissue YFB_cap_skin 0.986715 no
DIF_gill_tissue YFB_cap_tissue 0.811981 no
DIF_gill_tissue YFB_gill_tissue 0.779225 no
DIF_gill_tissue YFB_veil 0.800882 no
YFB_stipe_center YFB_stipe_shell 0.848584 no
YFB_stipe_center YFB_stipe_skin 0.771210 no
YFB_stipe_center YFB_cap_skin 0.275940 no
YFB_stipe_center YFB_cap_tissue 0.490893 no
YFB_stipe_center YFB_gill_tissue 0.540112 no
YFB_stipe_center YFB_veil 0.525308 no
YFB_stipe_shell YFB_stipe_skin 0.947130 no
YFB_stipe_shell YFB_cap_skin 0.125875 no
YFB_stipe_shell YFB_cap_tissue 0.281825 no
YFB_stipe_shell YFB_gill_tissue 0.315050 no
YFB_stipe_shell YFB_veil 0.306336 no
YFB_stipe_skin YFB_cap_skin 0.088269 no
YFB_stipe_skin YFB_cap_tissue 0.215732 no
YFB_stipe_skin YFB_gill_tissue 0.246828 no
YFB_stipe_skin YFB_veil 0.237117 no
YFB_cap_skin YFB_cap_tissue 0.835192 no
YFB_cap_skin YFB_gill_tissue 0.802797 no
YFB_cap_skin YFB_veil 0.823138 no
YFB_cap_tissue YFB_gill_tissue 0.976896 no
YFB_cap_tissue YFB_veil 0.989426 no
YFB_gill_tissue YFB_veil 0.987749 no
Initials DIF_gill_tissue 0.002951 yes
Initials YFB_stipe_center 0.179947 no
Initials YFB_stipe_shell 0.341941 no
Initials YFB_stipe_skin 0.415591 no
Initials YFB_cap_skin 0.004548 yes
Initials YFB_cap_tissue 0.014956 yes
Initials YFB_gill_tissue 0.020523 yes
Initials YFB_veil 0.018896 yes
Initials Pileal_Stipeal_center 0.172824 no
Initials Pileal_Stipeal_shell 0.004160 yes
Initials DIF_stipe_center 0.067520 no
Initials DIF_stipe_shell 0.213417 no
Initials DIF_stipe_skin 0.268563 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.279861 no
Pileal_Stipeal_center YFB_stipe_center 0.988674 no
Pileal_Stipeal_center YFB_stipe_shell 0.833635 no
Pileal_Stipeal_center YFB_stipe_skin 0.751271 no
Pileal_Stipeal_center YFB_cap_skin 0.294454 no
Pileal_Stipeal_center YFB_cap_tissue 0.508150 no
Pileal_Stipeal_center YFB_gill_tissue 0.555668 no
Pileal_Stipeal_center YFB_veil 0.540230 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.297207 no
Pileal_Stipeal_center DIF_stipe_center 0.840537 no
Pileal_Stipeal_center DIF_stipe_shell 0.946023 no
Pileal_Stipeal_center DIF_stipe_skin 0.906908 no
Pileal_Stipeal_center DIF_cap_skin 0.040947 yes
Pileal_Stipeal_center DIF_cap_tissue 0.054776 no
Pileal_Stipeal_shell DIF_gill_tissue 0.990353 no
Pileal_Stipeal_shell YFB_stipe_center 0.277689 no
Pileal_Stipeal_shell YFB_stipe_shell 0.131110 no
Pileal_Stipeal_shell YFB_stipe_skin 0.092841 no
Pileal_Stipeal_shell YFB_cap_skin 0.995947 no
Pileal_Stipeal_shell YFB_cap_tissue 0.833046 no
Pileal_Stipeal_shell YFB_gill_tissue 0.801561 no
Pileal_Stipeal_shell YFB_veil 0.820607 no
Pileal_Stipeal_shell DIF_stipe_center 0.497754 no
Pileal_Stipeal_shell DIF_stipe_shell 0.221143 no
Pileal_Stipeal_shell DIF_stipe_skin 0.182683 no
Pileal_Stipeal_shell DIF_cap_skin 0.577425 no
Pileal_Stipeal_shell DIF_cap_tissue 0.624220 no
DIF_stipe_center DIF_gill_tissue 0.472250 no
DIF_stipe_center YFB_stipe_center 0.821834 no
DIF_stipe_center YFB_stipe_shell 0.602108 no
DIF_stipe_center YFB_stipe_skin 0.509529 no
DIF_stipe_center YFB_cap_skin 0.494957 no
DIF_stipe_center YFB_cap_tissue 0.735768 no
DIF_stipe_center YFB_gill_tissue 0.779658 no
DIF_stipe_center YFB_veil 0.761074 no
DIF_stipe_center DIF_stipe_shell 0.752354 no
DIF_stipe_center DIF_stipe_skin 0.698351 no
DIF_stipe_center DIF_cap_skin 0.107122 no
DIF_stipe_center DIF_cap_tissue 0.128227 no
DIF_stipe_shell DIF_gill_tissue 0.203521 no
DIF_stipe_shell YFB_stipe_center 0.957828 no
DIF_stipe_shell YFB_stipe_shell 0.899921 no
DIF_stipe_shell YFB_stipe_skin 0.828116 no
DIF_stipe_shell YFB_cap_skin 0.215847 no
DIF_stipe_shell YFB_cap_tissue 0.414928 no
DIF_stipe_shell YFB_gill_tissue 0.461332 no
DIF_stipe_shell YFB_veil 0.446415 no
DIF_stipe_shell DIF_stipe_skin 0.962032 no
DIF_stipe_shell DIF_cap_skin 0.024946 yes
DIF_stipe_shell DIF_cap_tissue 0.033444 yes
DIF_stipe_skin DIF_gill_tissue 0.164623 no
DIF_stipe_skin YFB_stipe_center 0.917550 no
DIF_stipe_skin YFB_stipe_shell 0.944271 no
DIF_stipe_skin YFB_stipe_skin 0.882903 no
DIF_stipe_skin YFB_cap_skin 0.175153 no
DIF_stipe_skin YFB_cap_tissue 0.354472 no
DIF_stipe_skin YFB_gill_tissue 0.399135 no
DIF_stipe_skin YFB_veil 0.385378 no
DIF_stipe_skin DIF_cap_skin 0.021846 yes
DIF_stipe_skin DIF_cap_tissue 0.025963 yes
DIF_cap_skin DIF_gill_tissue 0.588047 no
DIF_cap_skin YFB_stipe_center 0.042692 yes
DIF_cap_skin YFB_stipe_shell 0.013485 yes
DIF_cap_skin YFB_stipe_skin 0.008457 yes
DIF_cap_skin YFB_cap_skin 0.567498 no
DIF_cap_skin YFB_cap_tissue 0.335141 no
DIF_cap_skin YFB_gill_tissue 0.302307 no
DIF_cap_skin YFB_veil 0.328183 no
DIF_cap_skin DIF_cap_tissue 0.971256 no
DIF_cap_tissue DIF_gill_tissue 0.634475 no
DIF_cap_tissue YFB_stipe_center 0.050499 no
DIF_cap_tissue YFB_stipe_shell 0.018624 yes
DIF_cap_tissue YFB_stipe_skin 0.010728 yes
DIF_cap_tissue YFB_cap_skin 0.613942 no
DIF_cap_tissue YFB_cap_tissue 0.376394 no
DIF_cap_tissue YFB_gill_tissue 0.343010 no
DIF_cap_tissue YFB_veil 0.370828 no

Orthologs

Orthofinder run ID1
Orthogroup3822
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|047690
Agaricus bisporus var bisporus H97 AgabiH97|047690 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|17_34

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047690
MPFGLTMGTERANALQQSIQDELTKRGYSQDADPVMAEYITIMVINNKTAGQITTELEDLIGSEYDPTFTDWLFV
EAAKGTSVPETSPQSQPLPPPSPPNDLPTREPPTHPPRDSSTRTSHPPRSGIYQQAVSQATSSVSSQKRSASARS
PSPGLPNKSRKTDLPTGPRAMQREGGPANSRSLLDRMSGHAASNRHQRDEIQARIDNITNNSPEANMMMSGGGFP
GMPMAGMDMNAVAMANPLMLQEMFMNNMALMQHLSSQIGVMQGFTNAPPGYNISGNGVINEAGAFHGGPNNFGQT
HRGRGSGRGRGGGRGRGGSHVGASSSPKVTEAAMLTEVPATPFNVSSQSPVNVPATATIASPAPTPVAAVPTATS
GQTSSVSQIPYAVPERPQSPTLCKFGLKCTNMHCRWSHPSPVATPESGVVLSNEACENGKYCKDKDCIKAHVSPA
TLNPPAQPPIPAPAAVAHTPSNSTPCRFGLACTRPNCMFSHPSRPASNSQYATPCRFGAACTRAACPYQHPEGRV
LPTAFHRGLAPNGPMAHIPNPETGSMGSSPHRSMTFNNPKAKLEKQVKDLEERKNDAEKAIKEAQVAAASSSNGK
EELKPVATAA*
Coding >AgabiH97|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGCAATCCATCCAGGATGAACTTACGAAG
CGAGGTTATAGTCAGGATGCTGACCCTGTAATGGCAGAGTATATCACTATCATGGTGATCAACAACAAGACTGCT
GGTCAAATCACTACAGAATTAGAAGATTTGATTGGCTCAGAGTATGACCCTACATTCACAGATTGGTTGTTTGTA
GAAGCAGCAAAAGGTACCAGTGTGCCTGAAACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAAT
GACCTGCCTACGCGCGAGCCTCCCACTCACCCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGC
GGTATCTACCAACAGGCGGTTTCTCAAGCCACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCA
CCATCACCCGGCCTTCCAAATAAGTCCCGAAAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGT
GGACCAGCGAATAGTCGGAGTCTGCTAGATCGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAG
ATCCAAGCCCGTATTGACAACATTACGAATAATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCG
GGCATGCCTATGGCGGGGATGGACATGAACGCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATG
AACAATATGGCTCTCATGCAACACCTATCATCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGG
TACAATATCTCAGGAAATGGTGTCATAAACGAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACA
CACAGGGGCAGGGGTAGCGGGAGAGGTAGAGGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCT
TCTCCTAAGGTGACTGAAGCCGCAATGTTGACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCT
GTTAATGTTCCTGCGACTGCCACTATTGCATCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCA
GGACAAACATCGTCTGTTTCGCAAATACCTTACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTT
GGTCTAAAATGCACTAACATGCATTGTCGGTGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTG
CTCAGCAACGAAGCTTGTGAAAACGGCAAGTACTGTAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCA
ACTCTTAACCCTCCTGCTCAACCCCCAATTCCAGCTCCCGCTGCCGTAGCTCACACGCCTTCTAATTCTACCCCC
TGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTAGGCCAGCTTCCAACTCGCAA
TATGCTACACCTTGTCGTTTCGGTGCCGCTTGTACGCGTGCAGCCTGCCCCTACCAGCATCCAGAAGGTCGTGTG
CTACCCACTGCCTTCCACCGTGGATTAGCGCCAAATGGCCCTATGGCACATATACCAAATCCTGAAACGGGTTCA
ATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGGAGAAGCAAGTGAAGGATCTG
GAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAGCTTCAAGTTCTAATGGGAAG
GAGGAACTTAAACCAGTTGCGACTGCAGCTTAA
Transcript >AgabiH97|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGCAATCCATCCAGGATGAACTTACGAAG
CGAGGTTATAGTCAGGATGCTGACCCTGTAATGGCAGAGTATATCACTATCATGGTGATCAACAACAAGACTGCT
GGTCAAATCACTACAGAATTAGAAGATTTGATTGGCTCAGAGTATGACCCTACATTCACAGATTGGTTGTTTGTA
GAAGCAGCAAAAGGTACCAGTGTGCCTGAAACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAAT
GACCTGCCTACGCGCGAGCCTCCCACTCACCCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGC
GGTATCTACCAACAGGCGGTTTCTCAAGCCACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCA
CCATCACCCGGCCTTCCAAATAAGTCCCGAAAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGT
GGACCAGCGAATAGTCGGAGTCTGCTAGATCGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAG
ATCCAAGCCCGTATTGACAACATTACGAATAATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCG
GGCATGCCTATGGCGGGGATGGACATGAACGCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATG
AACAATATGGCTCTCATGCAACACCTATCATCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGG
TACAATATCTCAGGAAATGGTGTCATAAACGAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACA
CACAGGGGCAGGGGTAGCGGGAGAGGTAGAGGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCT
TCTCCTAAGGTGACTGAAGCCGCAATGTTGACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCT
GTTAATGTTCCTGCGACTGCCACTATTGCATCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCA
GGACAAACATCGTCTGTTTCGCAAATACCTTACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTT
GGTCTAAAATGCACTAACATGCATTGTCGGTGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTG
CTCAGCAACGAAGCTTGTGAAAACGGCAAGTACTGTAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCA
ACTCTTAACCCTCCTGCTCAACCCCCAATTCCAGCTCCCGCTGCCGTAGCTCACACGCCTTCTAATTCTACCCCC
TGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTAGGCCAGCTTCCAACTCGCAA
TATGCTACACCTTGTCGTTTCGGTGCCGCTTGTACGCGTGCAGCCTGCCCCTACCAGCATCCAGAAGGTCGTGTG
CTACCCACTGCCTTCCACCGTGGATTAGCGCCAAATGGCCCTATGGCACATATACCAAATCCTGAAACGGGTTCA
ATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGGAGAAGCAAGTGAAGGATCTG
GAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAGCTTCAAGTTCTAATGGGAAG
GAGGAACTTAAACCAGTTGCGACTGCAGCTTAA
Gene >AgabiH97|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGGTAAGCTATGCCTCGCACAATTTAAGC
TAGATTTTTTGTGAATTTATCTGCCCTTTTACAGCAATCCATCCAGGATGAACTTACGAAGCGAGGTTATAGTCA
GGATGCTGGTGAGTCGGCCTACGACATAAGGCGTGCATCAGAACCTGAGCAACGTTTTAGACCCTGTAATGGCAG
AGTATATCACTATCATGGTGATCAACAACAAGACTGCTGGTACGTGTTGGTGTTCATTTTCCCCCTCGCCGACTC
ACACTTTGTTCAGGTCAAATCACTACAGAATTAGAAGATTGTATGTGTTTTTCTATCTCTTTTTTGTTTTTGATA
TCATTGACGCATCATTCACTCTAGTGATTGGCTCAGAGTATGGTAAAGACCAATAACTTATTTCTCCCGACTCTT
GCTAACTTTTACCTAGACCCTACATTCACAGATTGGTTGTTTGTAGAAGCAGCAAAAGGTACCAGTGTGCCTGAA
ACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAATGACCTGCCTACGCGCGAGCCTCCCACTCAC
CCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGCGGTATCTACCAACAGGCGGTTTCTCAAGCC
ACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCACCATCACCCGGCCTTCCAAATAAGTCCCGA
AAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGTGGACCAGCGAATAGTCGGAGTCTGCTAGAT
CGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAGATCCAAGCCCGTATTGACAACATTACGAAT
AATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCGGGCATGCCTATGGCGGGGATGGACATGAAC
GCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATGAACAATATGGCTCTCATGCAACACCTATCA
TCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGGTACAATATCTCAGGAAATGGTGTCATAAAC
GAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACACACAGGGGCAGGGGTAGCGGGAGAGGTAGA
GGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCTTCTCCTAAGGTGACTGAAGCCGCAATGTTG
ACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCTGTTAATGTTCCTGCGACTGCCACTATTGCA
TCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCAGGACAAACATCGTCTGTTTCGCAAATACCT
TACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTTGGTCTAAAATGCACTAACATGCATTGTCGG
TGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTGCTCAGCAACGAAGCTTGTGAAAACGGCAAG
TACTGTAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCAACTCTTAACCCTCCTGGTATGTTTCTCCGC
TATAGTCGAAGAGCTTTTGATGAGACTGTTTTCTAGCTCAACCCCCAATTCCAGCTCCCGCTGCCGTAGCTCACA
CGCCTTCTAATTCTACCCCCTGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTA
GGCCAGCTTCCAACTCGCAATATGCTACACCTTGTCGTTTCGGTGCCGCTTGTACGCGTGCAGCCTGCCCCTACC
AGCATCCAGAAGGTCGTGTGCTACCCACTGCCTTCCACCGTGGATTAGCGCCAAATGGCCCTATGGCACATATAC
CAAATCCTGAAACGGGTTCAATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGG
AGAAGCAAGTGAAGGATCTGGAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAG
CTTCAAGTTCTAATGGGAAGGAGGAACTTAAACCAGTTGCGACTGCAGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail