Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047690
Gene name
Locationscaffold_2:2278918..2281071
Strand+
Gene length (bp)2153
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.3E-02 397 414
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 9.4E-05 475 492
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.6E-02 504 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 397 494 9.0E-15
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 396 537 2.0E-13
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 12 87 2.0E-08
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 380 537 3.0E-07
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 390 521 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 397 494 9.0E-15
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 396 537 2.0E-13
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 12 87 2.0E-08
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 380 537 3.0E-07
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 390 521 5.0E-07
sp|Q8BJ05|ZC3HE_MOUSE Zinc finger CCCH domain-containing protein 14 OS=Mus musculus GN=Zc3h14 PE=1 SV=1 380 538 3.0E-06
sp|Q08AZ1|ZC3HE_XENLA Zinc finger CCCH domain-containing protein 14 OS=Xenopus laevis GN=zc3h14 PE=2 SV=2 398 521 3.0E-06
sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus GN=Zc3h14 PE=1 SV=1 380 536 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047690
MPFGLTMGTERANALQQSIQDELTKRGYSQDADPVMAEYITIMVINNKTAGQITTELEDLIGSEYDPTFTDWLFV
EAAKGTSVPETSPQSQPLPPPSPPNDLPTREPPTHPPRDSSTRTSHPPRSGIYQQAVSQATSSVSSQKRSASARS
PSPGLPNKSRKTDLPTGPRAMQREGGPANSRSLLDRMSGHAASNRHQRDEIQARIDNITNNSPEANMMMSGGGFP
GMPMAGMDMNAVAMANPLMLQEMFMNNMALMQHLSSQIGVMQGFTNAPPGYNISGNGVINEAGAFHGGPNNFGQT
HRGRGSGRGRGGGRGRGGSHVGASSSPKVTEAAMLTEVPATPFNVSSQSPVNVPATATIASPAPTPVAAVPTATS
GQTSSVSQIPYAVPERPQSPTLCKFGLKCTNMHCRWSHPSPVATPESGVVLSNEACENGKYCKDKDCIKAHVSPA
TLNPPAQPPIPAPAAVAHTPSNSTPCRFGLACTRPNCMFSHPSRPASNSQYATPCRFGAACTRAACPYQHPEGRV
LPTAFHRGLAPNGPMAHIPNPETGSMGSSPHRSMTFNNPKAKLEKQVKDLEERKNDAEKAIKEAQVAAASSSNGK
EELKPVATAA*
Coding >AgabiH97|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGCAATCCATCCAGGATGAACTTACGAAG
CGAGGTTATAGTCAGGATGCTGACCCTGTAATGGCAGAGTATATCACTATCATGGTGATCAACAACAAGACTGCT
GGTCAAATCACTACAGAATTAGAAGATTTGATTGGCTCAGAGTATGACCCTACATTCACAGATTGGTTGTTTGTA
GAAGCAGCAAAAGGTACCAGTGTGCCTGAAACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAAT
GACCTGCCTACGCGCGAGCCTCCCACTCACCCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGC
GGTATCTACCAACAGGCGGTTTCTCAAGCCACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCA
CCATCACCCGGCCTTCCAAATAAGTCCCGAAAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGT
GGACCAGCGAATAGTCGGAGTCTGCTAGATCGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAG
ATCCAAGCCCGTATTGACAACATTACGAATAATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCG
GGCATGCCTATGGCGGGGATGGACATGAACGCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATG
AACAATATGGCTCTCATGCAACACCTATCATCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGG
TACAATATCTCAGGAAATGGTGTCATAAACGAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACA
CACAGGGGCAGGGGTAGCGGGAGAGGTAGAGGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCT
TCTCCTAAGGTGACTGAAGCCGCAATGTTGACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCT
GTTAATGTTCCTGCGACTGCCACTATTGCATCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCA
GGACAAACATCGTCTGTTTCGCAAATACCTTACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTT
GGTCTAAAATGCACTAACATGCATTGTCGGTGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTG
CTCAGCAACGAAGCTTGTGAAAACGGCAAGTACTGTAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCA
ACTCTTAACCCTCCTGCTCAACCCCCAATTCCAGCTCCCGCTGCCGTAGCTCACACGCCTTCTAATTCTACCCCC
TGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTAGGCCAGCTTCCAACTCGCAA
TATGCTACACCTTGTCGTTTCGGTGCCGCTTGTACGCGTGCAGCCTGCCCCTACCAGCATCCAGAAGGTCGTGTG
CTACCCACTGCCTTCCACCGTGGATTAGCGCCAAATGGCCCTATGGCACATATACCAAATCCTGAAACGGGTTCA
ATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGGAGAAGCAAGTGAAGGATCTG
GAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAGCTTCAAGTTCTAATGGGAAG
GAGGAACTTAAACCAGTTGCGACTGCAGCTTAA
Transcript >AgabiH97|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGCAATCCATCCAGGATGAACTTACGAAG
CGAGGTTATAGTCAGGATGCTGACCCTGTAATGGCAGAGTATATCACTATCATGGTGATCAACAACAAGACTGCT
GGTCAAATCACTACAGAATTAGAAGATTTGATTGGCTCAGAGTATGACCCTACATTCACAGATTGGTTGTTTGTA
GAAGCAGCAAAAGGTACCAGTGTGCCTGAAACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAAT
GACCTGCCTACGCGCGAGCCTCCCACTCACCCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGC
GGTATCTACCAACAGGCGGTTTCTCAAGCCACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCA
CCATCACCCGGCCTTCCAAATAAGTCCCGAAAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGT
GGACCAGCGAATAGTCGGAGTCTGCTAGATCGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAG
ATCCAAGCCCGTATTGACAACATTACGAATAATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCG
GGCATGCCTATGGCGGGGATGGACATGAACGCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATG
AACAATATGGCTCTCATGCAACACCTATCATCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGG
TACAATATCTCAGGAAATGGTGTCATAAACGAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACA
CACAGGGGCAGGGGTAGCGGGAGAGGTAGAGGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCT
TCTCCTAAGGTGACTGAAGCCGCAATGTTGACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCT
GTTAATGTTCCTGCGACTGCCACTATTGCATCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCA
GGACAAACATCGTCTGTTTCGCAAATACCTTACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTT
GGTCTAAAATGCACTAACATGCATTGTCGGTGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTG
CTCAGCAACGAAGCTTGTGAAAACGGCAAGTACTGTAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCA
ACTCTTAACCCTCCTGCTCAACCCCCAATTCCAGCTCCCGCTGCCGTAGCTCACACGCCTTCTAATTCTACCCCC
TGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTAGGCCAGCTTCCAACTCGCAA
TATGCTACACCTTGTCGTTTCGGTGCCGCTTGTACGCGTGCAGCCTGCCCCTACCAGCATCCAGAAGGTCGTGTG
CTACCCACTGCCTTCCACCGTGGATTAGCGCCAAATGGCCCTATGGCACATATACCAAATCCTGAAACGGGTTCA
ATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGGAGAAGCAAGTGAAGGATCTG
GAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAGCTTCAAGTTCTAATGGGAAG
GAGGAACTTAAACCAGTTGCGACTGCAGCTTAA
Gene >AgabiH97|047690
ATGCCTTTCGGTCTTACTATGGGTACGGAGCGGGCAAATGCCCTACAGGTAAGCTATGCCTCGCACAATTTAAGC
TAGATTTTTTGTGAATTTATCTGCCCTTTTACAGCAATCCATCCAGGATGAACTTACGAAGCGAGGTTATAGTCA
GGATGCTGGTGAGTCGGCCTACGACATAAGGCGTGCATCAGAACCTGAGCAACGTTTTAGACCCTGTAATGGCAG
AGTATATCACTATCATGGTGATCAACAACAAGACTGCTGGTACGTGTTGGTGTTCATTTTCCCCCTCGCCGACTC
ACACTTTGTTCAGGTCAAATCACTACAGAATTAGAAGATTGTATGTGTTTTTCTATCTCTTTTTTGTTTTTGATA
TCATTGACGCATCATTCACTCTAGTGATTGGCTCAGAGTATGGTAAAGACCAATAACTTATTTCTCCCGACTCTT
GCTAACTTTTACCTAGACCCTACATTCACAGATTGGTTGTTTGTAGAAGCAGCAAAAGGTACCAGTGTGCCTGAA
ACTTCGCCGCAGTCTCAACCCTTGCCACCTCCCTCTCCCCCAAATGACCTGCCTACGCGCGAGCCTCCCACTCAC
CCGCCTCGAGACAGTTCGACTCGTACTTCCCACCCGCCACGTAGCGGTATCTACCAACAGGCGGTTTCTCAAGCC
ACTTCATCTGTCTCATCTCAAAAGCGTTCTGCATCTGCGCGTTCACCATCACCCGGCCTTCCAAATAAGTCCCGA
AAAACTGACTTGCCTACGGGGCCGCGAGCAATGCAACGTGAAGGTGGACCAGCGAATAGTCGGAGTCTGCTAGAT
CGTATGAGTGGTCATGCTGCATCCAATAGGCATCAACGCGACGAGATCCAAGCCCGTATTGACAACATTACGAAT
AATTCCCCAGAAGCCAATATGATGATGAGTGGTGGTGGATTCCCGGGCATGCCTATGGCGGGGATGGACATGAAC
GCTGTGGCAATGGCTAATCCCCTTATGCTTCAAGAAATGTTCATGAACAATATGGCTCTCATGCAACACCTATCA
TCGCAAATTGGAGTGATGCAGGGCTTCACGAATGCGCCACCCGGGTACAATATCTCAGGAAATGGTGTCATAAAC
GAGGCGGGGGCGTTTCATGGAGGTCCCAATAATTTTGGACAAACACACAGGGGCAGGGGTAGCGGGAGAGGTAGA
GGAGGTGGTAGGGGGCGTGGTGGTTCTCATGTGGGCGCATCATCTTCTCCTAAGGTGACTGAAGCCGCAATGTTG
ACTGAAGTTCCTGCAACGCCATTCAATGTCTCTTCCCAATCCCCTGTTAATGTTCCTGCGACTGCCACTATTGCA
TCCCCTGCACCTACCCCCGTTGCTGCTGTTCCTACCGCCACCTCAGGACAAACATCGTCTGTTTCGCAAATACCT
TACGCAGTACCCGAGCGGCCTCAGTCCCCAACGCTCTGTAAATTTGGTCTAAAATGCACTAACATGCATTGTCGG
TGGTCACACCCTTCACCTGTCGCGACCCCAGAAAGTGGTGTCGTGCTCAGCAACGAAGCTTGTGAAAACGGCAAG
TACTGTAAAGACAAGGACTGTATAAAGGCCCACGTGAGCCCCGCAACTCTTAACCCTCCTGGTATGTTTCTCCGC
TATAGTCGAAGAGCTTTTGATGAGACTGTTTTCTAGCTCAACCCCCAATTCCAGCTCCCGCTGCCGTAGCTCACA
CGCCTTCTAATTCTACCCCCTGCCGCTTTGGCCTTGCGTGCACTCGACCGAATTGCATGTTTAGCCACCCTTCTA
GGCCAGCTTCCAACTCGCAATATGCTACACCTTGTCGTTTCGGTGCCGCTTGTACGCGTGCAGCCTGCCCCTACC
AGCATCCAGAAGGTCGTGTGCTACCCACTGCCTTCCACCGTGGATTAGCGCCAAATGGCCCTATGGCACATATAC
CAAATCCTGAAACGGGTTCAATGGGCTCTAGTCCTCACAGAAGCATGACTTTCAATAATCCAAAAGCGAAATTGG
AGAAGCAAGTGAAGGATCTGGAAGAGAGAAAAAATGATGCTGAGAAAGCCATCAAGGAGGCGCAAGTAGCTGCAG
CTTCAAGTTCTAATGGGAAGGAGGAACTTAAACCAGTTGCGACTGCAGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail