Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047490
Gene name
Locationscaffold_2:2221812..2223392
Strand+
Gene length (bp)1580
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13896 Glyco_transf_49 Glycosyl-transferase for dystroglycan 1.4E-09 88 156
PF13896 Glyco_transf_49 Glycosyl-transferase for dystroglycan 3.1E-57 159 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P7A1|LARG2_RAT Glycosyltransferase-like protein LARGE2 OS=Rattus norvegicus GN=Gyltl1b PE=2 SV=1 87 347 1.0E-25
sp|Q5XPT3|LARG2_MOUSE Glycosyltransferase-like protein LARGE2 OS=Mus musculus GN=Gyltl1b PE=2 SV=1 88 347 3.0E-23
sp|Q66PG1|LARG2_DANRE Glycosyltransferase-like protein LARGE2 OS=Danio rerio GN=gyltl1b PE=2 SV=1 88 347 5.0E-23
sp|Q66PG4|LARG2_CHICK Glycosyltransferase-like protein LARGE2 OS=Gallus gallus GN=GYLTL1B PE=2 SV=1 88 347 8.0E-23
sp|O95461|LARGE_HUMAN Glycosyltransferase-like protein LARGE1 OS=Homo sapiens GN=LARGE PE=1 SV=1 88 376 9.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P7A1|LARG2_RAT Glycosyltransferase-like protein LARGE2 OS=Rattus norvegicus GN=Gyltl1b PE=2 SV=1 87 347 1.0E-25
sp|Q5XPT3|LARG2_MOUSE Glycosyltransferase-like protein LARGE2 OS=Mus musculus GN=Gyltl1b PE=2 SV=1 88 347 3.0E-23
sp|Q66PG1|LARG2_DANRE Glycosyltransferase-like protein LARGE2 OS=Danio rerio GN=gyltl1b PE=2 SV=1 88 347 5.0E-23
sp|Q66PG4|LARG2_CHICK Glycosyltransferase-like protein LARGE2 OS=Gallus gallus GN=GYLTL1B PE=2 SV=1 88 347 8.0E-23
sp|O95461|LARGE_HUMAN Glycosyltransferase-like protein LARGE1 OS=Homo sapiens GN=LARGE PE=1 SV=1 88 376 9.0E-23
sp|Q8N3Y3|LARG2_HUMAN Glycosyltransferase-like protein LARGE2 OS=Homo sapiens GN=GYLTL1B PE=1 SV=2 88 347 2.0E-22
sp|Q54PG8|GNT14_DICDI Glycosyltransferase-like protein gnt14 OS=Dictyostelium discoideum GN=gnt14 PE=2 SV=1 86 393 2.0E-22
sp|Q6PA90|LRG2A_XENLA Glycosyltransferase-like protein LARGE2-A OS=Xenopus laevis GN=gyltl1b-a PE=2 SV=1 48 376 9.0E-22
sp|Q66PG2|LARGE_DANRE Glycosyltransferase-like protein LARGE1 OS=Danio rerio GN=large PE=2 SV=1 88 376 1.0E-21
sp|Q9Z1M7|LARGE_MOUSE Glycosyltransferase-like protein LARGE1 OS=Mus musculus GN=Large PE=1 SV=1 88 376 2.0E-21
sp|Q32NJ7|LRG2B_XENLA Glycosyltransferase-like protein LARGE2-B OS=Xenopus laevis GN=gyltl1b-b PE=2 SV=1 88 376 3.0E-21
sp|Q66PG3|LARGE_CHICK Glycosyltransferase-like protein LARGE1 OS=Gallus gallus GN=LARGE PE=2 SV=1 88 347 6.0E-21
sp|Q8BWP8|B4GA1_MOUSE Beta-1,4-glucuronyltransferase 1 OS=Mus musculus GN=B4gat1 PE=1 SV=1 87 381 1.0E-15
sp|O43505|B4GA1_HUMAN Beta-1,4-glucuronyltransferase 1 OS=Homo sapiens GN=B4GAT1 PE=1 SV=1 87 376 4.0E-15
sp|Q5R4S2|B4GA1_PONAB Beta-1,4-glucuronyltransferase 1 OS=Pongo abelii GN=B4GAT1 PE=2 SV=1 87 376 5.0E-15
sp|Q5EA01|B4GA1_BOVIN Beta-1,4-glucuronyltransferase 1 OS=Bos taurus GN=B4GAT1 PE=2 SV=2 87 376 2.0E-14
sp|Q21389|LGE1_CAEEL Glycosyltransferase-like protein LARGE OS=Caenorhabditis elegans GN=lge-1 PE=3 SV=3 98 379 1.0E-13
sp|L7YAI7|B4GA1_DANRE Beta-1,4-glucuronyltransferase 1 OS=Danio rerio GN=b4gat1 PE=2 SV=1 87 376 1.0E-11
sp|Q555X4|GNT15_DICDI Glycosyltransferase-like protein gnt15 OS=Dictyostelium discoideum GN=gnt15 PE=2 SV=1 222 361 1.0E-09
sp|Q555X4|GNT15_DICDI Glycosyltransferase-like protein gnt15 OS=Dictyostelium discoideum GN=gnt15 PE=2 SV=1 79 184 5.0E-09
sp|Q54SH2|GNT13_DICDI Glycosyltransferase-like protein gnt13 OS=Dictyostelium discoideum GN=gnt13 PE=2 SV=1 221 347 1.0E-08
sp|Q54SH2|GNT13_DICDI Glycosyltransferase-like protein gnt13 OS=Dictyostelium discoideum GN=gnt13 PE=2 SV=1 74 184 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047490
MFHICIALYIILSVLFTTSSLLSSSSNSNSGNLFTRDLRKQIVLESTDLERHYVDESIILSKAFPHLMKPSQIIP
YYLRASGVFHKHDITITSIITSNRFEILARLAQRYQGPISVTLHINNATENVPHLLESLHNLYNTTPNMAVYVDV
HLVLDTFDRQFNTWRNIARLFARTEYVMMLDVDFYICTDFRETLQNLLQVDGNGEIGEGENIREMFNNGVAAFVV
PAFEYINYKEGREYKTFPKTKEHLMQLVQQRRIGMFHRVWAPGHNSTDYDRFYSAKPGEIYKVTQFHSAYEPYTI
FRKDGPPWCDERFIGYGGNKAACIYEMYLSGISFYVLSDHFIIHQNHLYEEKTRKNERRFNRKIYTDFKEETCLR
YLRNFHDMRSLKTPKARNMIEECSRNKKLSGLIAQVQ*
Coding >AgabiH97|047490
ATGTTCCATATCTGCATTGCCCTCTACATCATTCTTTCTGTCCTATTCACCACGAGCTCCCTGCTCTCATCATCG
TCTAACTCGAATTCAGGCAATCTCTTCACTCGCGATCTCCGAAAACAGATAGTTCTCGAGTCGACGGACCTTGAA
CGACATTATGTTGATGAAAGCATAATACTGTCCAAGGCGTTTCCTCATCTCATGAAACCGAGTCAAATCATCCCA
TACTACCTCCGCGCCTCGGGAGTATTCCACAAACACGATATCACTATTACTAGCATTATCACAAGTAACCGCTTT
GAGATTCTTGCACGTCTCGCTCAACGGTATCAAGGTCCTATATCGGTGACACTCCACATCAACAATGCTACCGAA
AACGTTCCTCACCTCCTCGAATCTTTACACAACCTATATAACACTACGCCTAACATGGCTGTCTATGTCGACGTT
CACCTCGTTTTGGATACTTTCGATCGTCAATTTAATACCTGGAGAAATATCGCCCGGTTGTTCGCAAGAACGGAA
TATGTTATGATGCTCGATGTGGACTTTTATATCTGCACAGATTTTAGAGAGACACTCCAGAACCTTTTGCAAGTC
GATGGTAACGGAGAAATTGGAGAAGGAGAGAATATAAGAGAAATGTTCAATAATGGGGTGGCTGCGTTTGTGGTT
CCGGCTTTTGAGTATATTAATTATAAAGAGGGGCGGGAGTACAAGACATTTCCGAAGACCAAGGAGCATCTGATG
CAATTGGTGCAACAGCGCAGGATTGGGATGTTTCACAGAGTTTGGGCTCCAGGTCATAACAGTACCGACTATGAT
AGGTTCTACTCCGCCAAACCCGGCGAAATCTACAAGGTCACCCAATTCCATTCAGCCTACGAACCTTATACGATT
TTTCGTAAGGATGGTCCACCATGGTGTGATGAGAGGTTCATCGGATACGGCGGAAACAAAGCAGCGTGTATTTAC
GAGATGTATCTCTCTGGAATCTCGTTCTACGTTCTTTCGGACCATTTCATCATTCATCAAAATCATTTATACGAG
GAAAAGACGAGAAAGAACGAGAGAAGATTCAATCGGAAGATATACACTGATTTCAAAGAAGAAACGTGTCTCCGG
TACTTACGAAATTTTCACGATATGAGGTCTTTGAAAACTCCAAAAGCGAGGAATATGATAGAGGAATGCAGCAGG
AACAAGAAACTCTCTGGTCTAATTGCACAAGTTCAATAA
Transcript >AgabiH97|047490
ATGTTCCATATCTGCATTGCCCTCTACATCATTCTTTCTGTCCTATTCACCACGAGCTCCCTGCTCTCATCATCG
TCTAACTCGAATTCAGGCAATCTCTTCACTCGCGATCTCCGAAAACAGATAGTTCTCGAGTCGACGGACCTTGAA
CGACATTATGTTGATGAAAGCATAATACTGTCCAAGGCGTTTCCTCATCTCATGAAACCGAGTCAAATCATCCCA
TACTACCTCCGCGCCTCGGGAGTATTCCACAAACACGATATCACTATTACTAGCATTATCACAAGTAACCGCTTT
GAGATTCTTGCACGTCTCGCTCAACGGTATCAAGGTCCTATATCGGTGACACTCCACATCAACAATGCTACCGAA
AACGTTCCTCACCTCCTCGAATCTTTACACAACCTATATAACACTACGCCTAACATGGCTGTCTATGTCGACGTT
CACCTCGTTTTGGATACTTTCGATCGTCAATTTAATACCTGGAGAAATATCGCCCGGTTGTTCGCAAGAACGGAA
TATGTTATGATGCTCGATGTGGACTTTTATATCTGCACAGATTTTAGAGAGACACTCCAGAACCTTTTGCAAGTC
GATGGTAACGGAGAAATTGGAGAAGGAGAGAATATAAGAGAAATGTTCAATAATGGGGTGGCTGCGTTTGTGGTT
CCGGCTTTTGAGTATATTAATTATAAAGAGGGGCGGGAGTACAAGACATTTCCGAAGACCAAGGAGCATCTGATG
CAATTGGTGCAACAGCGCAGGATTGGGATGTTTCACAGAGTTTGGGCTCCAGGTCATAACAGTACCGACTATGAT
AGGTTCTACTCCGCCAAACCCGGCGAAATCTACAAGGTCACCCAATTCCATTCAGCCTACGAACCTTATACGATT
TTTCGTAAGGATGGTCCACCATGGTGTGATGAGAGGTTCATCGGATACGGCGGAAACAAAGCAGCGTGTATTTAC
GAGATGTATCTCTCTGGAATCTCGTTCTACGTTCTTTCGGACCATTTCATCATTCATCAAAATCATTTATACGAG
GAAAAGACGAGAAAGAACGAGAGAAGATTCAATCGGAAGATATACACTGATTTCAAAGAAGAAACGTGTCTCCGG
TACTTACGAAATTTTCACGATATGAGGTCTTTGAAAACTCCAAAAGCGAGGAATATGATAGAGGAATGCAGCAGG
AACAAGAAACTCTCTGGTCTAATTGCACAAGTTCAATAA
Gene >AgabiH97|047490
ATGTTCCATATCTGCATTGCCCTCTACATCATTCTTTCTGTCCTATTCACCACGAGCTCCCTGCTCTCATCATCG
TCTAACTCGAATTCAGGCAATCTCTTCACTCGCGATCTCCGAAAACAGATAGTTCTCGAGTCGACGGACCTTGAA
CGACATTATGTTGATGAAAGCATAATACTGTCCAAGGCGTTTCCTCATCTCATGAAACCGAGTCAAATCATCCCA
TACTACCTCCGCGCCTCGGGAGTATTCCACAAACACGATATCACTATTACTAGCATTATCACAAGTAACCGCTTT
GAGATTCTTGCACGTCTCGCTCAACGGTATCAAGGTACGTATATTCGTCGCTCGCTTTCTTCTTAAGTCTATATA
TGCTACTCAAACCTCAGGTCCTATATCGGTGACACTCCACATCAACAATGCTACCGAAAACGTTCCTCACCTCCT
CGAATCTTTACACAACCTATATAACACTACGCCTAACATGGCTGTCTATGTCGACGTTCACCTCGTTTTGGATAC
TTTCGATCGTCAATTTAATACCTGGAGAAATATCGCCCGGTTGTTCGCAAGAACGGAATATGTTATGATGCTCGA
TGTGGACTTTTATATCTGCACAGATTTTAGAGAGACACTCCAGAACCTTTTGCAAGTCGATGGTAACGGAGAAAT
TGGAGAAGGAGAGAATATAAGAGAAATGTTCAATAATGGGGTGGCTGCGTTTGTGGTTCCGGCTTTTGAGTATAT
TAATTATAAAGAGGGGCGGGAGTACAAGACATTTCCGAAGACCAAGGAGGTAAGTCGTTTGATTATTTCAGTCGA
GGATTCAATTGAGTTTGCTTGTAGCATCTGATGCAATTGGTGCAACAGCGCAGGATTGGGATGTTTCACAGAGTT
TGGGCTCCAGGTCATAACAGTACCGACTATGATAGGTTCTACTCCGCCAAACCCGGCGAAATCTACAAGGTCACC
CAATTCCATTCAGCCTACGAACCTTATACGATTTTTCGTAAGGATGGTCCACCATGGTACGTCCCCGGGTTTTCT
TTCAGCTTGCCTTATACAGCTGTTTATTTCGACGTGCTCGAATTAGGTGTGATGAGAGGTTCATCGGATACGGCG
GAAACAAAGCAGCGTGTATTTACGAGATGTATCTCTCTGGAATCTCGTTCTACGTTCTTTCGGACCATTTCATCA
TTCATCAAAATCATTTATACGAGGAAAAGACGAGAAAGAACGAGGTATGTTGGGCTTTTTCTACTGTCTTTAGTT
TACACTGAGTCTTAGAACGGGTTGTAGAGAAGATTCAATCGGAAGATATACACTGATTTCAAAGAAGAAACGTGT
CTCCGGTAATCATTTTCCATGTTATAGAGAGAAGTGTTATTAAGATCACGCGCAGGTACTTACGAAATTTTCACG
ATATGAGGTCTTTGAAAACTCCAAAAGCGAGGAATATGATAGAGGAATGCAGCAGGAACAAGAAACTCTCTGGTC
TAATTGCACAAGTAAGTTTGAACGTGTCTCTTCAAGAGCGTTATCTATTATTGAAAGCTTAGCTAATTCAGGTTC
AATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail