Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047370
Gene name
Locationscaffold_2:2195689..2197265
Strand+
Gene length (bp)1576
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 40.81 18.65 62.97
Initials Initials knots 58.78 33.26 84.30
Pileal_Stipeal_center Stage I stipe center 11.77 5.57 17.97
Pileal_Stipeal_shell Stage I stipe shell 6.90 2.98 10.81
DIF_stipe_center Stage II stipe center 13.48 6.57 20.39
DIF_stipe_shell Stage II stipe shell 20.46 10.53 30.40
DIF_stipe_skin Stage II stipe skin 10.97 5.22 16.72
DIF_cap_skin Stage II cap skin 6.05 2.57 9.53
DIF_cap_tissue Stage II cap tissue 5.89 2.50 9.27
DIF_gill_tissue Stage II gill tissue 9.96 4.61 15.31
YFB_stipe_center Young fruiting body stipe center 16.15 7.57 24.73
YFB_stipe_shell Young fruiting body stipe shell 28.66 15.42 41.89
YFB_stipe_skin Young fruiting body stipe skin 16.00 8.01 24.00
YFB_cap_skin Young fruiting body cap skin 5.61 2.39 8.83
YFB_cap_tissue Young fruiting body cap tissue 5.53 2.36 8.70
YFB_gill_tissue Young fruiting body gill tissue 8.54 3.92 13.17
YFB_veil Young fruiting body veil 8.97 3.94 14.00

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.006032 yes
Casing YFB_stipe_shell 0.385626 no
Casing YFB_stipe_skin 0.005302 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.359938 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.001140 yes
Casing DIF_stipe_shell 0.043772 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.229251 no
DIF_gill_tissue YFB_stipe_shell 0.002084 yes
DIF_gill_tissue YFB_stipe_skin 0.224034 no
DIF_gill_tissue YFB_cap_skin 0.150574 no
DIF_gill_tissue YFB_cap_tissue 0.140144 no
DIF_gill_tissue YFB_gill_tissue 0.805181 no
DIF_gill_tissue YFB_veil 0.876218 no
YFB_stipe_center YFB_stipe_shell 0.102187 no
YFB_stipe_center YFB_stipe_skin 0.988778 no
YFB_stipe_center YFB_cap_skin 0.002084 yes
YFB_stipe_center YFB_cap_tissue 0.002951 yes
YFB_stipe_center YFB_gill_tissue 0.090658 no
YFB_stipe_center YFB_veil 0.139707 no
YFB_stipe_shell YFB_stipe_skin 0.080883 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.001625 yes
YFB_stipe_skin YFB_cap_skin 0.002084 yes
YFB_stipe_skin YFB_cap_tissue 0.003365 yes
YFB_stipe_skin YFB_gill_tissue 0.082277 no
YFB_stipe_skin YFB_veil 0.130530 no
YFB_cap_skin YFB_cap_tissue 0.986057 no
YFB_cap_skin YFB_gill_tissue 0.343969 no
YFB_cap_skin YFB_veil 0.283263 no
YFB_cap_tissue YFB_gill_tissue 0.330737 no
YFB_cap_tissue YFB_veil 0.270661 no
YFB_gill_tissue YFB_veil 0.947324 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.014081 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.771151 no
Pileal_Stipeal_center YFB_stipe_center 0.482694 no
Pileal_Stipeal_center YFB_stipe_shell 0.004548 yes
Pileal_Stipeal_center YFB_stipe_skin 0.483189 no
Pileal_Stipeal_center YFB_cap_skin 0.042260 yes
Pileal_Stipeal_center YFB_cap_tissue 0.040279 yes
Pileal_Stipeal_center YFB_gill_tissue 0.491747 no
Pileal_Stipeal_center YFB_veil 0.587128 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.177565 no
Pileal_Stipeal_center DIF_stipe_center 0.811072 no
Pileal_Stipeal_center DIF_stipe_shell 0.120521 no
Pileal_Stipeal_center DIF_stipe_skin 0.916129 no
Pileal_Stipeal_center DIF_cap_skin 0.073043 no
Pileal_Stipeal_center DIF_cap_tissue 0.062995 no
Pileal_Stipeal_shell DIF_gill_tissue 0.441072 no
Pileal_Stipeal_shell YFB_stipe_center 0.021583 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.019987 yes
Pileal_Stipeal_shell YFB_cap_skin 0.731058 no
Pileal_Stipeal_shell YFB_cap_tissue 0.713166 no
Pileal_Stipeal_shell YFB_gill_tissue 0.712595 no
Pileal_Stipeal_shell YFB_veil 0.631374 no
Pileal_Stipeal_shell DIF_stipe_center 0.072330 no
Pileal_Stipeal_shell DIF_stipe_shell 0.003765 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.269575 no
Pileal_Stipeal_shell DIF_cap_skin 0.847978 no
Pileal_Stipeal_shell DIF_cap_tissue 0.805790 no
DIF_stipe_center DIF_gill_tissue 0.499611 no
DIF_stipe_center YFB_stipe_center 0.733236 no
DIF_stipe_center YFB_stipe_shell 0.014956 yes
DIF_stipe_center YFB_stipe_skin 0.741401 no
DIF_stipe_center YFB_cap_skin 0.013186 yes
DIF_stipe_center YFB_cap_tissue 0.012577 yes
DIF_stipe_center YFB_gill_tissue 0.251000 no
DIF_stipe_center YFB_veil 0.332715 no
DIF_stipe_center DIF_stipe_shell 0.269850 no
DIF_stipe_center DIF_stipe_skin 0.681912 no
DIF_stipe_center DIF_cap_skin 0.025711 yes
DIF_stipe_center DIF_cap_tissue 0.021846 yes
DIF_stipe_shell DIF_gill_tissue 0.042260 yes
DIF_stipe_shell YFB_stipe_center 0.628194 no
DIF_stipe_shell YFB_stipe_shell 0.380153 no
DIF_stipe_shell YFB_stipe_skin 0.593554 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.011968 yes
DIF_stipe_shell YFB_veil 0.020523 yes
DIF_stipe_shell DIF_stipe_skin 0.077161 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.883944 no
DIF_stipe_skin YFB_stipe_center 0.357374 no
DIF_stipe_skin YFB_stipe_shell 0.002951 yes
DIF_stipe_skin YFB_stipe_skin 0.357803 no
DIF_stipe_skin YFB_cap_skin 0.076984 no
DIF_stipe_skin YFB_cap_tissue 0.072685 no
DIF_stipe_skin YFB_gill_tissue 0.623559 no
DIF_stipe_skin YFB_veil 0.718530 no
DIF_stipe_skin DIF_cap_skin 0.118854 no
DIF_stipe_skin DIF_cap_tissue 0.106507 no
DIF_cap_skin DIF_gill_tissue 0.233318 no
DIF_cap_skin YFB_stipe_center 0.004928 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.004548 yes
DIF_cap_skin YFB_cap_skin 0.917993 no
DIF_cap_skin YFB_cap_tissue 0.905081 no
DIF_cap_skin YFB_gill_tissue 0.474688 no
DIF_cap_skin YFB_veil 0.398297 no
DIF_cap_skin DIF_cap_tissue 0.972299 no
DIF_cap_tissue DIF_gill_tissue 0.201511 no
DIF_cap_tissue YFB_stipe_center 0.006032 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.005671 yes
DIF_cap_tissue YFB_cap_skin 0.950110 no
DIF_cap_tissue YFB_cap_tissue 0.936701 no
DIF_cap_tissue YFB_gill_tissue 0.426345 no
DIF_cap_tissue YFB_veil 0.355963 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047370
MYPAKTSLMQVLTLIVSLCLVLLGTVSAARVHIDTKVKGPHKKTSNCFPALDFDMPSTVPADSQLPSWWCDASTE
YAFLGFSYEVTACQSRSQLISEFKDIRNHFNSRYVRLYGACDRKNFYDDIVEAAWESGLGVHALVWFGFDGDDIW
IRRRDTLLAALHANPKAKWVTRVLQFGSEPLFDNVLPHQQLTEQVVAAQRNLSSLHIPVTVSELAFGYQERGGAQ
DLLDAIDSINIHMLPFFSQQASTAKNAWPLVLNDLQFFIDNGNGKKMYFDENGWPSVTSEGVQPNSPDAVADIPN
ERDYYTLLDEHCSDLKEVVGGGVGCESLIDALSRQS*
Coding >AgabiH97|047370
ATGTATCCGGCGAAAACTAGTCTGATGCAAGTCCTTACCCTCATCGTCTCTCTATGCCTGGTTCTACTGGGCACG
GTTTCAGCTGCCCGAGTGCATATTGATACCAAAGTCAAGGGGCCTCACAAGAAGACGAGCAATTGCTTTCCTGCC
CTCGATTTTGACATGCCTTCCACGGTACCGGCTGACTCACAGTTACCCTCCTGGTGGTGCGACGCAAGTACTGAA
TACGCTTTCCTGGGCTTCAGCTACGAAGTCACAGCTTGTCAAAGCAGGTCGCAACTCATATCTGAATTCAAGGAC
ATCCGAAACCATTTCAACTCGCGCTACGTTCGACTTTACGGCGCTTGCGACCGCAAAAACTTCTATGATGACATC
GTCGAGGCTGCTTGGGAGAGTGGTCTGGGAGTCCATGCGCTCGTCTGGTTTGGCTTTGACGGTGATGACATCTGG
ATTAGGCGACGCGACACGCTATTAGCAGCCCTACATGCAAACCCGAAAGCCAAATGGGTAACCCGAGTGTTGCAA
TTCGGATCGGAACCGCTTTTCGATAATGTCTTGCCTCATCAACAACTCACCGAGCAAGTGGTAGCTGCGCAAAGG
AATTTGTCTAGTCTGCATATTCCTGTAACTGTCTCTGAACTCGCGTTCGGCTACCAGGAACGTGGTGGAGCCCAG
GACTTACTCGACGCCATTGATTCAATTAATATCCATATGCTACCTTTCTTCTCCCAGCAGGCATCAACTGCGAAA
AATGCCTGGCCTCTAGTCTTAAACGACTTGCAATTTTTCATTGATAACGGCAACGGAAAGAAAATGTACTTTGAC
GAGAATGGATGGCCATCTGTCACCTCCGAAGGCGTGCAACCAAACAGTCCCGATGCTGTCGCCGATATACCAAAT
GAACGCGATTACTATACACTACTGGACGAACATTGTAGCGATCTCAAAGAAGTAGTTGGCGGCGGTGTCGGATGT
GAATCGTTAATTGACGCGCTCTCACGACAGAGCTAA
Transcript >AgabiH97|047370
ATGTATCCGGCGAAAACTAGTCTGATGCAAGTCCTTACCCTCATCGTCTCTCTATGCCTGGTTCTACTGGGCACG
GTTTCAGCTGCCCGAGTGCATATTGATACCAAAGTCAAGGGGCCTCACAAGAAGACGAGCAATTGCTTTCCTGCC
CTCGATTTTGACATGCCTTCCACGGTACCGGCTGACTCACAGTTACCCTCCTGGTGGTGCGACGCAAGTACTGAA
TACGCTTTCCTGGGCTTCAGCTACGAAGTCACAGCTTGTCAAAGCAGGTCGCAACTCATATCTGAATTCAAGGAC
ATCCGAAACCATTTCAACTCGCGCTACGTTCGACTTTACGGCGCTTGCGACCGCAAAAACTTCTATGATGACATC
GTCGAGGCTGCTTGGGAGAGTGGTCTGGGAGTCCATGCGCTCGTCTGGTTTGGCTTTGACGGTGATGACATCTGG
ATTAGGCGACGCGACACGCTATTAGCAGCCCTACATGCAAACCCGAAAGCCAAATGGGTAACCCGAGTGTTGCAA
TTCGGATCGGAACCGCTTTTCGATAATGTCTTGCCTCATCAACAACTCACCGAGCAAGTGGTAGCTGCGCAAAGG
AATTTGTCTAGTCTGCATATTCCTGTAACTGTCTCTGAACTCGCGTTCGGCTACCAGGAACGTGGTGGAGCCCAG
GACTTACTCGACGCCATTGATTCAATTAATATCCATATGCTACCTTTCTTCTCCCAGCAGGCATCAACTGCGAAA
AATGCCTGGCCTCTAGTCTTAAACGACTTGCAATTTTTCATTGATAACGGCAACGGAAAGAAAATGTACTTTGAC
GAGAATGGATGGCCATCTGTCACCTCCGAAGGCGTGCAACCAAACAGTCCCGATGCTGTCGCCGATATACCAAAT
GAACGCGATTACTATACACTACTGGACGAACATTGTAGCGATCTCAAAGAAGTAGTTGGCGGCGGTGTCGGATGT
GAATCGTTAATTGACGCGCTCTCACGACAGAGCTAA
Gene >AgabiH97|047370
ATGTATCCGGCGAAAACTAGTCTGATGCAAGTCCTTACCCTCATCGTCTCTCTATGCCTGGTTCTACTGGGCACG
GTTTCAGCTGCCCGAGTGCATATTGATACCAAAGTCAAGGGGCCTCACAAGAAGACGAGCAATTGCTTTCCTGCC
CTCGATTTTGACATGCCTTCCACGGTACCGGCTGACTCACAGTTACCCTCCTGGTGGTGCGACGCAAGTACTGAA
TACGCTTTCCTGGGCTTCAGCTACGAAGTCACAGCTTGTAGGTGATTTTCTTTGCTTTTACCATGTGTCTCATAG
GTCGCCTTCGACCCGAAGGTCAAAGCAGGTCGCAACTCATATCTGAATTCAAGGACATCCGAAACCATTTCAACT
CGCGCTACGTTCGACTTTACGGCGCTTGCGACCGCAAAAACTTCTAGTATGTTCCTTGCAATTGTATCGGCATTT
GTATTGACATAATGCTTATAGTGATGACATCGTCGAGGCTGCTTGGGAGAGTGGTCTGGGAGTCCATGCGCTCGT
CTGGGTAAGCTTAAATTTCGAAGACCACCCTTAGCTTAAAAGCTGAACGAGCCCCATTTGGCATCTTCGCTAAGT
TTGGCTTTGACGGTGATGACATCTGGATTAGGCGACGCGACACGCTATTAGCAGCCCTACATGCAAACCCGAAAG
CCAAATGGGTAACCCGAGTGTTGCAATTCGGATCGGAACCGCTTTTCGATAATGTCTTGCCTCATCAACAACTCA
CCGAGCAAGTGGTAGCTGCGCAAAGGAATTTGTCTAGTCTGCATATTCCTGTAACTGTCTCTGAACTCGCGTTCG
GGTATATCTATCCTATTGTTCTTGTTCGTCTGTTCTGATTTGTTCGTACAGCTACCAGGAACGTGGTGGAGCCCA
GGACTTACTCGACGCCATTGATTCAATTAATATCCATATGCTACCTTTCTTCTCCCAGCAGGCATCAACTGGTAG
GGCAATCAGCTAAGTCAGTGCCTCGGTAACAAATGCCTGACACAATCCATTTTAGCGAAAAATGCCTGGCCTCTA
GTCTTAAACGACTTGCAATTTTTCATTGATAACGGCAACGGAAAGAAAATGTACTTTGACGAGGCGAGACCCAGA
TCACTATTACATAGTCTTCACATCTCACGAAGAATATAGAATGGATGGCCATCTGTCACCTCCGAAGGCGTGCAA
CCAAACAGTCCCGATGCTGTCGCCGATATACCAAATGAACGCGTAAGCGTCGCTTCATTACTAGCATCATCCTGA
TCTGAAACTCAGACGTTCTGATAGGATTACTATACACTACTGGACGAACATTGTAGCGATCTCAAAGAAGTAGTT
GGCGGCGGTGTCGGATGGTTTGCTCACATCTATAGTGACGATCAAGAGCCGGGTTATGGGATATACAACACTAGA
GGGGAACTGAAATTTTCCTTCAACCCTCGCACTTCATGCTAACAAGTGAATCGTTAATGTATGCTCCACAGTCAA
GATTCAAATTATCGCAAACCCTTTCGCTGACCTCCTCGTCATCTCTAATAGTGACGCGCTCTCACGACAGAGCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail