Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047200
Gene name
Locationscaffold_2:2155088..2156775
Strand+
Gene length (bp)1687
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.7E-12 57 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40986|CDC1_YEAST Cell division control protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC1 PE=1 SV=2 9 356 3.0E-49
sp|Q9UUH0|YKIC_SCHPO Uncharacterized protein C630.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.12 PE=3 SV=1 23 382 3.0E-41
sp|Q0IHA5|MPPE1_XENLA Metallophosphoesterase 1 OS=Xenopus laevis GN=mppe1 PE=2 SV=1 19 382 4.0E-14
sp|Q9VLR9|MPPE1_DROME Metallophosphoesterase 1 homolog OS=Drosophila melanogaster GN=PGAP5 PE=2 SV=4 34 336 6.0E-14
sp|Q5ZK82|MPPE1_CHICK Metallophosphoesterase 1 OS=Gallus gallus GN=MPPE1 PE=2 SV=1 4 376 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40986|CDC1_YEAST Cell division control protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC1 PE=1 SV=2 9 356 3.0E-49
sp|Q9UUH0|YKIC_SCHPO Uncharacterized protein C630.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.12 PE=3 SV=1 23 382 3.0E-41
sp|Q0IHA5|MPPE1_XENLA Metallophosphoesterase 1 OS=Xenopus laevis GN=mppe1 PE=2 SV=1 19 382 4.0E-14
sp|Q9VLR9|MPPE1_DROME Metallophosphoesterase 1 homolog OS=Drosophila melanogaster GN=PGAP5 PE=2 SV=4 34 336 6.0E-14
sp|Q5ZK82|MPPE1_CHICK Metallophosphoesterase 1 OS=Gallus gallus GN=MPPE1 PE=2 SV=1 4 376 1.0E-11
sp|Q566Y9|MPPE1_DANRE Metallophosphoesterase 1 OS=Danio rerio GN=mppe1 PE=2 SV=1 8 384 1.0E-11
sp|Q80XL7|MPPE1_MOUSE Metallophosphoesterase 1 OS=Mus musculus GN=Mppe1 PE=2 SV=1 23 355 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 360 382 22
2 444 466 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 33.81 19.51 48.12
Initials Initials knots 31.34 17.94 44.74
Pileal_Stipeal_center Stage I stipe center 35.07 20.15 49.99
Pileal_Stipeal_shell Stage I stipe shell 40.98 23.71 58.25
DIF_stipe_center Stage II stipe center 33.31 19.20 47.43
DIF_stipe_shell Stage II stipe shell 31.02 17.57 44.48
DIF_stipe_skin Stage II stipe skin 34.74 19.95 49.54
DIF_cap_skin Stage II cap skin 49.71 29.42 69.99
DIF_cap_tissue Stage II cap tissue 48.42 28.70 68.14
DIF_gill_tissue Stage II gill tissue 41.50 24.33 58.66
YFB_stipe_center Young fruiting body stipe center 39.31 22.91 55.71
YFB_stipe_shell Young fruiting body stipe shell 29.79 16.99 42.60
YFB_stipe_skin Young fruiting body stipe skin 34.32 19.73 48.92
YFB_cap_skin Young fruiting body cap skin 45.02 26.54 63.49
YFB_cap_tissue Young fruiting body cap tissue 43.25 25.22 61.29
YFB_gill_tissue Young fruiting body gill tissue 38.93 22.76 55.10
YFB_veil Young fruiting body veil 39.03 22.60 55.47

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.597622 no
Casing YFB_stipe_center 0.732089 no
Casing YFB_stipe_shell 0.785020 no
Casing YFB_stipe_skin 0.979607 no
Casing YFB_cap_skin 0.408132 no
Casing YFB_cap_tissue 0.498235 no
Casing YFB_gill_tissue 0.753958 no
Casing YFB_veil 0.744489 no
Casing Initials 0.886054 no
Casing Pileal_Stipeal_center 0.950110 no
Casing Pileal_Stipeal_shell 0.634235 no
Casing DIF_stipe_center 0.978665 no
Casing DIF_stipe_shell 0.869603 no
Casing DIF_stipe_skin 0.963557 no
Casing DIF_cap_skin 0.211358 no
Casing DIF_cap_tissue 0.252082 no
DIF_gill_tissue YFB_stipe_center 0.920423 no
DIF_gill_tissue YFB_stipe_shell 0.311935 no
DIF_gill_tissue YFB_stipe_skin 0.642716 no
DIF_gill_tissue YFB_cap_skin 0.871073 no
DIF_gill_tissue YFB_cap_tissue 0.940862 no
DIF_gill_tissue YFB_gill_tissue 0.903665 no
DIF_gill_tissue YFB_veil 0.908018 no
YFB_stipe_center YFB_stipe_shell 0.422001 no
YFB_stipe_center YFB_stipe_skin 0.765525 no
YFB_stipe_center YFB_cap_skin 0.757537 no
YFB_stipe_center YFB_cap_tissue 0.845991 no
YFB_stipe_center YFB_gill_tissue 0.985341 no
YFB_stipe_center YFB_veil 0.989491 no
YFB_stipe_shell YFB_stipe_skin 0.752491 no
YFB_stipe_shell YFB_cap_skin 0.166579 no
YFB_stipe_shell YFB_cap_tissue 0.236256 no
YFB_stipe_shell YFB_gill_tissue 0.443507 no
YFB_stipe_shell YFB_veil 0.434560 no
YFB_stipe_skin YFB_cap_skin 0.445917 no
YFB_stipe_skin YFB_cap_tissue 0.543768 no
YFB_stipe_skin YFB_gill_tissue 0.789330 no
YFB_stipe_skin YFB_veil 0.779225 no
YFB_cap_skin YFB_cap_tissue 0.941758 no
YFB_cap_skin YFB_gill_tissue 0.733493 no
YFB_cap_skin YFB_veil 0.736707 no
YFB_cap_tissue YFB_gill_tissue 0.826576 no
YFB_cap_tissue YFB_veil 0.829461 no
YFB_gill_tissue YFB_veil 0.995472 no
Initials DIF_gill_tissue 0.413186 no
Initials YFB_stipe_center 0.545643 no
Initials YFB_stipe_shell 0.927730 no
Initials YFB_stipe_skin 0.860021 no
Initials YFB_cap_skin 0.243319 no
Initials YFB_cap_tissue 0.333265 no
Initials YFB_gill_tissue 0.570822 no
Initials YFB_veil 0.563074 no
Initials Pileal_Stipeal_center 0.816867 no
Initials Pileal_Stipeal_shell 0.454283 no
Initials DIF_stipe_center 0.909976 no
Initials DIF_stipe_shell 0.985920 no
Initials DIF_stipe_skin 0.835271 no
Initials DIF_cap_skin 0.114120 no
Initials DIF_cap_tissue 0.140144 no
Pileal_Stipeal_center DIF_gill_tissue 0.688749 no
Pileal_Stipeal_center YFB_stipe_center 0.813374 no
Pileal_Stipeal_center YFB_stipe_shell 0.706926 no
Pileal_Stipeal_center YFB_stipe_skin 0.970398 no
Pileal_Stipeal_center YFB_cap_skin 0.493659 no
Pileal_Stipeal_center YFB_cap_tissue 0.592918 no
Pileal_Stipeal_center YFB_gill_tissue 0.830994 no
Pileal_Stipeal_center YFB_veil 0.823034 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.723996 no
Pileal_Stipeal_center DIF_stipe_center 0.925445 no
Pileal_Stipeal_center DIF_stipe_shell 0.798913 no
Pileal_Stipeal_center DIF_stipe_skin 0.986745 no
Pileal_Stipeal_center DIF_cap_skin 0.274857 no
Pileal_Stipeal_center DIF_cap_tissue 0.326217 no
Pileal_Stipeal_shell DIF_gill_tissue 0.983844 no
Pileal_Stipeal_shell YFB_stipe_center 0.943135 no
Pileal_Stipeal_shell YFB_stipe_shell 0.342473 no
Pileal_Stipeal_shell YFB_stipe_skin 0.677355 no
Pileal_Stipeal_shell YFB_cap_skin 0.851606 no
Pileal_Stipeal_shell YFB_cap_tissue 0.923966 no
Pileal_Stipeal_shell YFB_gill_tissue 0.927680 no
Pileal_Stipeal_shell YFB_veil 0.930907 no
Pileal_Stipeal_shell DIF_stipe_center 0.605638 no
Pileal_Stipeal_shell DIF_stipe_shell 0.443302 no
Pileal_Stipeal_shell DIF_stipe_skin 0.705569 no
Pileal_Stipeal_shell DIF_cap_skin 0.630816 no
Pileal_Stipeal_shell DIF_cap_tissue 0.687043 no
DIF_stipe_center DIF_gill_tissue 0.568695 no
DIF_stipe_center YFB_stipe_center 0.699220 no
DIF_stipe_center YFB_stipe_shell 0.816770 no
DIF_stipe_center YFB_stipe_skin 0.959887 no
DIF_stipe_center YFB_cap_skin 0.374329 no
DIF_stipe_center YFB_cap_tissue 0.472104 no
DIF_stipe_center YFB_gill_tissue 0.721924 no
DIF_stipe_center YFB_veil 0.711723 no
DIF_stipe_center DIF_stipe_shell 0.895454 no
DIF_stipe_center DIF_stipe_skin 0.941542 no
DIF_stipe_center DIF_cap_skin 0.193249 no
DIF_stipe_center DIF_cap_tissue 0.230028 no
DIF_stipe_shell DIF_gill_tissue 0.407377 no
DIF_stipe_shell YFB_stipe_center 0.531625 no
DIF_stipe_shell YFB_stipe_shell 0.945158 no
DIF_stipe_shell YFB_stipe_skin 0.844780 no
DIF_stipe_shell YFB_cap_skin 0.239533 no
DIF_stipe_shell YFB_cap_tissue 0.330998 no
DIF_stipe_shell YFB_gill_tissue 0.556534 no
DIF_stipe_shell YFB_veil 0.549091 no
DIF_stipe_shell DIF_stipe_skin 0.821079 no
DIF_stipe_shell DIF_cap_skin 0.111482 no
DIF_stipe_shell DIF_cap_tissue 0.142080 no
DIF_stipe_skin DIF_gill_tissue 0.660594 no
DIF_stipe_skin YFB_stipe_center 0.788895 no
DIF_stipe_skin YFB_stipe_shell 0.722528 no
DIF_stipe_skin YFB_stipe_skin 0.983404 no
DIF_stipe_skin YFB_cap_skin 0.462263 no
DIF_stipe_skin YFB_cap_tissue 0.564693 no
DIF_stipe_skin YFB_gill_tissue 0.809147 no
DIF_stipe_skin YFB_veil 0.799788 no
DIF_stipe_skin DIF_cap_skin 0.246933 no
DIF_stipe_skin DIF_cap_tissue 0.297108 no
DIF_cap_skin DIF_gill_tissue 0.643533 no
DIF_cap_skin YFB_stipe_center 0.511668 no
DIF_cap_skin YFB_stipe_shell 0.061662 no
DIF_cap_skin YFB_stipe_skin 0.237769 no
DIF_cap_skin YFB_cap_skin 0.832755 no
DIF_cap_skin YFB_cap_tissue 0.747416 no
DIF_cap_skin YFB_gill_tissue 0.492001 no
DIF_cap_skin YFB_veil 0.493171 no
DIF_cap_skin DIF_cap_tissue 0.960549 no
DIF_cap_tissue DIF_gill_tissue 0.712726 no
DIF_cap_tissue YFB_stipe_center 0.581758 no
DIF_cap_tissue YFB_stipe_shell 0.087251 no
DIF_cap_tissue YFB_stipe_skin 0.288589 no
DIF_cap_tissue YFB_cap_skin 0.884771 no
DIF_cap_tissue YFB_cap_tissue 0.809956 no
DIF_cap_tissue YFB_gill_tissue 0.557035 no
DIF_cap_tissue YFB_veil 0.562694 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047200
MNFLPRNRRVVTLLRLFWLVLSLWYEHFVFQASVRSCTWPKPKAVDQQNIDGPPPSHILIIADPQILDHRSYPGR
PAFLTYLTRLVVDLNLRKNWRAAIAKNPDAVVFLGDMMDGGRMDMSDDEYEDYYSRFKDIFRMDKAIYQFYIPGN
HDTGLQSRSVFSPLARSRYISHFGPLNNRASISNHTLLFFDAPGFVQEDYERAGQRKSFAEWRPKVGGPFEFVRT
VGEVNDLDPAVLFTHIPLYRPDGKSCGPLREKGTIRPGVGFGYQNTLGKDSTSFVLHQMRPTVVFSGDDHDYCEH
THQSVISTPVNEVTIKSLSMAMNVRKPGFQLLSLFPATTWDNVNPTYAHVPCLLPDQLGIYQGVYIPCALVSLLI
VIVAAVMRGRTSDHDKKNISKLPDPATNPHQNQTSVVCFGRRRRLLGLGCLFGNKGSRRTSKRGLVQNILRDVLD
IAVFPISIFVIVTVLISL*
Coding >AgabiH97|047200
ATGAATTTCTTGCCACGAAATCGTAGAGTAGTCACCCTACTCCGTCTTTTCTGGCTGGTCCTTTCTCTTTGGTAC
GAGCACTTTGTATTTCAAGCATCAGTAAGGTCATGTACTTGGCCCAAACCAAAAGCGGTCGACCAGCAAAACATC
GATGGCCCACCGCCCTCGCACATCCTCATCATCGCTGACCCTCAAATTCTTGACCACCGTTCCTACCCAGGTCGC
CCGGCGTTTCTGACCTACCTGACGCGCTTGGTTGTTGATCTCAACCTCAGAAAGAACTGGCGAGCAGCTATTGCC
AAGAACCCCGATGCAGTTGTGTTTCTCGGTGATATGATGGACGGCGGAAGGATGGACATGTCAGACGATGAATAC
GAGGACTATTATTCCCGTTTCAAGGATATCTTTCGCATGGACAAGGCTATATACCAGTTTTACATTCCTGGAAAT
CATGATACGGGGCTACAGTCTCGATCCGTATTCTCGCCTCTCGCGCGCTCACGCTATATATCCCATTTTGGACCT
TTAAACAATCGAGCGTCCATATCTAATCACACCCTTTTGTTCTTCGACGCCCCTGGATTTGTTCAAGAAGATTAC
GAACGTGCTGGACAACGAAAATCCTTTGCCGAATGGAGACCAAAAGTTGGTGGTCCTTTTGAATTCGTCAGAACA
GTGGGAGAAGTGAATGATCTTGATCCCGCCGTTTTATTCACTCACATCCCTCTCTATCGACCTGATGGCAAGTCC
TGTGGTCCATTGCGAGAAAAAGGTACTATTCGACCGGGTGTCGGCTTTGGGTACCAGAACACGTTGGGCAAGGAT
TCGACCTCTTTTGTGTTGCATCAGATGAGACCGACAGTAGTCTTCAGCGGTGATGATCACGACTATTGCGAACAC
ACTCATCAATCGGTCATTTCAACTCCAGTTAACGAAGTCACTATTAAATCGCTTTCCATGGCTATGAATGTTCGA
AAGCCTGGCTTTCAGCTTCTATCTCTATTCCCCGCGACTACATGGGACAATGTCAATCCTACCTATGCCCACGTT
CCATGTCTGCTTCCCGACCAACTAGGAATCTATCAAGGCGTGTACATACCCTGCGCTCTTGTGTCTCTTCTTATC
GTGATTGTCGCTGCTGTGATGCGCGGTCGAACAAGTGACCATGATAAAAAAAACATTTCCAAGTTACCGGACCCA
GCTACAAATCCTCACCAAAACCAAACTTCCGTTGTGTGTTTTGGCCGGCGACGCCGCCTTCTCGGCCTTGGTTGT
CTTTTTGGCAATAAAGGGTCTCGCAGAACGTCGAAGCGTGGACTGGTACAGAACATTTTACGAGATGTATTGGAT
ATTGCTGTGTTTCCCATAAGTATATTCGTCATTGTCACTGTCCTTATTTCGCTATGA
Transcript >AgabiH97|047200
ATGAATTTCTTGCCACGAAATCGTAGAGTAGTCACCCTACTCCGTCTTTTCTGGCTGGTCCTTTCTCTTTGGTAC
GAGCACTTTGTATTTCAAGCATCAGTAAGGTCATGTACTTGGCCCAAACCAAAAGCGGTCGACCAGCAAAACATC
GATGGCCCACCGCCCTCGCACATCCTCATCATCGCTGACCCTCAAATTCTTGACCACCGTTCCTACCCAGGTCGC
CCGGCGTTTCTGACCTACCTGACGCGCTTGGTTGTTGATCTCAACCTCAGAAAGAACTGGCGAGCAGCTATTGCC
AAGAACCCCGATGCAGTTGTGTTTCTCGGTGATATGATGGACGGCGGAAGGATGGACATGTCAGACGATGAATAC
GAGGACTATTATTCCCGTTTCAAGGATATCTTTCGCATGGACAAGGCTATATACCAGTTTTACATTCCTGGAAAT
CATGATACGGGGCTACAGTCTCGATCCGTATTCTCGCCTCTCGCGCGCTCACGCTATATATCCCATTTTGGACCT
TTAAACAATCGAGCGTCCATATCTAATCACACCCTTTTGTTCTTCGACGCCCCTGGATTTGTTCAAGAAGATTAC
GAACGTGCTGGACAACGAAAATCCTTTGCCGAATGGAGACCAAAAGTTGGTGGTCCTTTTGAATTCGTCAGAACA
GTGGGAGAAGTGAATGATCTTGATCCCGCCGTTTTATTCACTCACATCCCTCTCTATCGACCTGATGGCAAGTCC
TGTGGTCCATTGCGAGAAAAAGGTACTATTCGACCGGGTGTCGGCTTTGGGTACCAGAACACGTTGGGCAAGGAT
TCGACCTCTTTTGTGTTGCATCAGATGAGACCGACAGTAGTCTTCAGCGGTGATGATCACGACTATTGCGAACAC
ACTCATCAATCGGTCATTTCAACTCCAGTTAACGAAGTCACTATTAAATCGCTTTCCATGGCTATGAATGTTCGA
AAGCCTGGCTTTCAGCTTCTATCTCTATTCCCCGCGACTACATGGGACAATGTCAATCCTACCTATGCCCACGTT
CCATGTCTGCTTCCCGACCAACTAGGAATCTATCAAGGCGTGTACATACCCTGCGCTCTTGTGTCTCTTCTTATC
GTGATTGTCGCTGCTGTGATGCGCGGTCGAACAAGTGACCATGATAAAAAAAACATTTCCAAGTTACCGGACCCA
GCTACAAATCCTCACCAAAACCAAACTTCCGTTGTGTGTTTTGGCCGGCGACGCCGCCTTCTCGGCCTTGGTTGT
CTTTTTGGCAATAAAGGGTCTCGCAGAACGTCGAAGCGTGGACTGGTACAGAACATTTTACGAGATGTATTGGAT
ATTGCTGTGTTTCCCATAAGTATATTCGTCATTGTCACTGTCCTTATTTCGCTATGA
Gene >AgabiH97|047200
ATGAATTTCTTGCCACGAAATCGTAGAGTAGTCACCCTACTCCGTCTTTTCTGGCTGGTCCTTTCTCTTTGGTAC
GAGCACTTTGTATTTCAAGCATCAGTAAGGTCATGTACTTGGCCCAAACCAAAAGCGGTCGACCAGGTGAGTCGA
ACAACTTGCTGGTCTAACAACCTTCATCCCGACACTCCATTACCAGCAAAACATCGATGGCCCACCGCCCTCGCA
CATCCTCATCATCGCTGACCCTCAAATTCTTGACCACCGTTCCTACCCAGGTCGCCCGGCGTTTCTGACCTACCT
GACGCGCTTGGTTGTTGATCTCAACCTCAGAAAGAACTGGCGAGCAGCTATTGCCAAGAACCCCGATGCAGTTGT
GTTTCTCGGTGATATGATGGACGGCGGAAGGATGGACATGTCAGACGATGAGTATGTACCATAACGCTGGCTTTT
GTAGTCCTGAAGCACCACCTAATCTTCGTTTGTGTTGATTCCAGATACGAGGACTATTATTCCCGTTTCAAGGAT
ATCTTTCGCATGGACAAGGCTATATACCAGTTTTACATTCCTGGAAATCATGATACGGGGTATGAAGAATAAATC
TATCGCATCGGACGCAGTCTGACCATCTTACCAGGCTACAGTCTCGATCCGTATTCTCGCCTCTCGCGCGCTCAC
GCTATATATCCCATTTTGGACCTTTAAACAATCGAGCGTCCATATCTAATCACACCCTTTTGTTCTTCGACGCCC
CTGGATTTGTTCAAGAAGATTACGAACGTGCTGGACAACGAAAATCCTTTGCCGAATGGAGACCAAAAGTTGGTG
GTCCTTTTGAATTCGTCAGAACAGTGGGAGAAGGTGATTCCTCAATCTACTTCGTACCTTTCAACTCATCCCTTA
GTTGTAAAAACCCAGTGAATGATCTTGATCCCGCCGTTTTATTCACTCACATCCCTCTCTATCGACCTGATGGCA
AGTCCTGTGGTCCATTGCGAGAAAAAGGTACTATTCGACCGGGTGTCGGCTTTGGGTACCAGAACACGTTGGGCA
AGGATTCGACCTCTTTTGTGTTGCATCAGATGAGACCGACAGTAGTCTTCAGGTAAATCAGGCCAAACGCTTATT
CCGTCCCTTTATTAAATCACTCTCCAGCGGTGATGATCACGACTATTGCGAACACACTCATCAATCGGTCATTTC
AACTCCAGTTAACGAAGTCACTATTAAATCGCTTTCCATGGCTATGAATGTTCGAAAGCCTGGCTTTCAGCTTCT
ATCTCTATTCCCCGCGACTACATGGGACAATGTCAATCCTACCTATGCCCACGTTCCATGTCTGCTTCCCGACCA
ACTAGGAATCTATCAAGGCGTGTACATACCCTGCGCTCTTGTGTCTCTTCTTATCGTGATTGTCGCTGCTGTGAT
GCGCGGTCGAACAAGTGACCATGATAAAAAAAACATTTCCAAGTTACCGGACCCAGCTACAAATCCTCACCAAAA
CCAAACTTCCGTTGTGTGTTTTGGCCGGCGACGCCGCCTTCTCGGCCTTGGTTGTCTTTTTGGCAATAAAGGGTC
TCGCAGAACGTCGAAGCGTGGACTGGTACAGAACATTTTACGAGATGTATTGGATATTGCTGTGTTTCCCATAAG
TATATTCGTCATTGTCACTGTCCTTATTTCGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail