Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047160
Gene name
Locationscaffold_2:2145467..2147187
Strand-
Gene length (bp)1720
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03909 BSD BSD domain 1.7E-08 349 384

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2BIJ3|BSDC1_DANRE BSD domain-containing protein 1 OS=Danio rerio GN=bsdc1 PE=1 SV=1 277 390 2.0E-07
sp|Q6NTW1|BSC1B_XENLA BSD domain-containing protein 1-B OS=Xenopus laevis GN=bsdc1-b PE=2 SV=1 277 395 8.0E-07
sp|Q3SX22|BSDC1_BOVIN BSD domain-containing protein 1 OS=Bos taurus GN=BSDC1 PE=2 SV=1 277 390 1.0E-06
sp|Q5BJ78|BSDC1_XENTR BSD domain-containing protein 1 OS=Xenopus tropicalis GN=bsdc1 PE=2 SV=1 277 390 1.0E-06
sp|Q9NW68|BSDC1_HUMAN BSD domain-containing protein 1 OS=Homo sapiens GN=BSDC1 PE=1 SV=1 277 390 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2BIJ3|BSDC1_DANRE BSD domain-containing protein 1 OS=Danio rerio GN=bsdc1 PE=1 SV=1 277 390 2.0E-07
sp|Q6NTW1|BSC1B_XENLA BSD domain-containing protein 1-B OS=Xenopus laevis GN=bsdc1-b PE=2 SV=1 277 395 8.0E-07
sp|Q3SX22|BSDC1_BOVIN BSD domain-containing protein 1 OS=Bos taurus GN=BSDC1 PE=2 SV=1 277 390 1.0E-06
sp|Q5BJ78|BSDC1_XENTR BSD domain-containing protein 1 OS=Xenopus tropicalis GN=bsdc1 PE=2 SV=1 277 390 1.0E-06
sp|Q9NW68|BSDC1_HUMAN BSD domain-containing protein 1 OS=Homo sapiens GN=BSDC1 PE=1 SV=1 277 390 1.0E-06
sp|Q80Y55|BSDC1_MOUSE BSD domain-containing protein 1 OS=Mus musculus GN=Bsdc1 PE=1 SV=1 277 390 2.0E-06
sp|Q6INU2|BSC1A_XENLA BSD domain-containing protein 1-A OS=Xenopus laevis GN=bsdc1-a PE=2 SV=1 277 390 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047160
MNFLDTYDISASSAGSSTPPPNQSQQTLNEEVNQVIGQLGRFWGGFRKQSQTVLETARRDIGDVVTQAQKELTKL
ANTAAEEPNTERETRRSSSREYEEEATPMSASVSTIQGTSSTDSSTESSGHANVQPQPGSNTQTLFSRLQSALPP
NVLSTVQNHIPESIKNASENVDLTQIRMNLLSEVQRIQGVTRAQAEEYAHKSEALLREAVKEAQEVFKDAVKVIP
PEGSSASSASATSGLIWDGTDMWTLPGVAETNSDAADADASSGKGKGKSVDSGAAAVATRAEALLRRLKHDPAIV
RVDPGVDGTTKDKYTAWIKNEVVSKGGIAGEEWRTVISKSLDDSIDGQALTSLKDVLVPSELAEQEFWQRFFFRV
HQIKEEEEKRKALLQANTESEDEFDWDDEDSEHEDENKGEVTKEATPAQDKSMATINNPGLAPPSSTTSTRESSL
DSFDVVSSANASVSGDRRTQHVKAAEKDDDEDEDEDEDDSDWE*
Coding >AgabiH97|047160
ATGAACTTCCTTGATACCTACGACATCTCCGCGAGTTCAGCGGGTTCTTCGACCCCTCCGCCTAATCAATCCCAA
CAAACACTAAACGAAGAAGTCAACCAGGTCATTGGACAATTGGGGCGCTTTTGGGGTGGTTTCAGAAAGCAGAGC
CAAACTGTCCTTGAAACAGCCCGAAGAGACATCGGGGATGTTGTTACTCAGGCTCAGAAAGAACTCACGAAGCTA
GCAAACACTGCTGCGGAGGAACCGAATACTGAACGAGAAACTCGGAGATCAAGTTCTAGAGAATACGAGGAAGAA
GCTACACCAATGTCGGCTTCCGTGTCGACCATTCAGGGAACAAGCTCAACTGATTCCTCTACTGAGTCCTCAGGT
CATGCCAATGTCCAACCCCAACCTGGCTCGAACACTCAAACTCTTTTCTCTCGACTGCAATCCGCTCTTCCACCA
AATGTCTTATCGACGGTACAGAACCATATTCCCGAATCAATTAAAAACGCATCTGAGAACGTCGACCTTACGCAA
ATTCGGATGAACCTATTGTCTGAGGTTCAAAGAATCCAGGGTGTAACAAGGGCACAAGCAGAGGAATATGCGCAC
AAGAGCGAAGCATTGTTGCGAGAAGCCGTCAAAGAAGCGCAGGAGGTGTTTAAAGATGCTGTCAAGGTTATTCCC
CCTGAGGGTTCCAGCGCATCATCAGCCTCCGCGACATCTGGTCTCATCTGGGATGGTACGGACATGTGGACGTTG
CCAGGAGTCGCTGAAACGAACTCTGATGCTGCGGATGCGGATGCAAGTTCCGGGAAAGGTAAAGGGAAGAGCGTG
GATTCTGGAGCAGCTGCTGTGGCTACGAGGGCGGAAGCTTTGCTCAGAAGGTTAAAACACGATCCTGCTATTGTT
CGGGTGGATCCCGGAGTAGATGGGACTACGAAAGACAAGTATACAGCGTGGATAAAGAATGAGGTTGTATCAAAA
GGAGGTATTGCAGGCGAAGAATGGCGAACGGTAATTTCCAAGAGCTTGGACGACAGCATCGATGGTCAAGCTCTA
ACGAGTTTGAAGGACGTGCTCGTTCCATCCGAGTTGGCTGAACAAGAATTTTGGCAACGTTTCTTCTTCCGCGTT
CATCAGATCAAGGAGGAGGAAGAAAAACGCAAAGCTCTATTACAAGCTAATACCGAGAGTGAGGACGAATTTGAT
TGGGACGACGAAGATTCTGAGCATGAAGACGAAAACAAAGGGGAAGTAACAAAAGAGGCAACACCTGCTCAAGAC
AAGTCGATGGCAACAATCAATAACCCAGGTCTCGCACCTCCCTCTTCAACGACATCAACGAGAGAAAGCAGCCTT
GACAGCTTCGATGTCGTTTCTTCGGCAAATGCCAGTGTTTCTGGAGACAGACGTACTCAACATGTCAAAGCTGCC
GAAAAAGACGATGATGAAGATGAAGATGAAGATGAAGATGACAGCGACTGGGAGTAG
Transcript >AgabiH97|047160
ATGAACTTCCTTGATACCTACGACATCTCCGCGAGTTCAGCGGGTTCTTCGACCCCTCCGCCTAATCAATCCCAA
CAAACACTAAACGAAGAAGTCAACCAGGTCATTGGACAATTGGGGCGCTTTTGGGGTGGTTTCAGAAAGCAGAGC
CAAACTGTCCTTGAAACAGCCCGAAGAGACATCGGGGATGTTGTTACTCAGGCTCAGAAAGAACTCACGAAGCTA
GCAAACACTGCTGCGGAGGAACCGAATACTGAACGAGAAACTCGGAGATCAAGTTCTAGAGAATACGAGGAAGAA
GCTACACCAATGTCGGCTTCCGTGTCGACCATTCAGGGAACAAGCTCAACTGATTCCTCTACTGAGTCCTCAGGT
CATGCCAATGTCCAACCCCAACCTGGCTCGAACACTCAAACTCTTTTCTCTCGACTGCAATCCGCTCTTCCACCA
AATGTCTTATCGACGGTACAGAACCATATTCCCGAATCAATTAAAAACGCATCTGAGAACGTCGACCTTACGCAA
ATTCGGATGAACCTATTGTCTGAGGTTCAAAGAATCCAGGGTGTAACAAGGGCACAAGCAGAGGAATATGCGCAC
AAGAGCGAAGCATTGTTGCGAGAAGCCGTCAAAGAAGCGCAGGAGGTGTTTAAAGATGCTGTCAAGGTTATTCCC
CCTGAGGGTTCCAGCGCATCATCAGCCTCCGCGACATCTGGTCTCATCTGGGATGGTACGGACATGTGGACGTTG
CCAGGAGTCGCTGAAACGAACTCTGATGCTGCGGATGCGGATGCAAGTTCCGGGAAAGGTAAAGGGAAGAGCGTG
GATTCTGGAGCAGCTGCTGTGGCTACGAGGGCGGAAGCTTTGCTCAGAAGGTTAAAACACGATCCTGCTATTGTT
CGGGTGGATCCCGGAGTAGATGGGACTACGAAAGACAAGTATACAGCGTGGATAAAGAATGAGGTTGTATCAAAA
GGAGGTATTGCAGGCGAAGAATGGCGAACGGTAATTTCCAAGAGCTTGGACGACAGCATCGATGGTCAAGCTCTA
ACGAGTTTGAAGGACGTGCTCGTTCCATCCGAGTTGGCTGAACAAGAATTTTGGCAACGTTTCTTCTTCCGCGTT
CATCAGATCAAGGAGGAGGAAGAAAAACGCAAAGCTCTATTACAAGCTAATACCGAGAGTGAGGACGAATTTGAT
TGGGACGACGAAGATTCTGAGCATGAAGACGAAAACAAAGGGGAAGTAACAAAAGAGGCAACACCTGCTCAAGAC
AAGTCGATGGCAACAATCAATAACCCAGGTCTCGCACCTCCCTCTTCAACGACATCAACGAGAGAAAGCAGCCTT
GACAGCTTCGATGTCGTTTCTTCGGCAAATGCCAGTGTTTCTGGAGACAGACGTACTCAACATGTCAAAGCTGCC
GAAAAAGACGATGATGAAGATGAAGATGAAGATGAAGATGACAGCGACTGGGAGTAG
Gene >AgabiH97|047160
ATGAACTTCCTTGATACCTACGACATCTCCGCGAGTTCAGCGGGTTCTTCGACCCCTCCGCCTAATCAATCCCAA
CAAACACTAAACGAAGAAGTCAACCAGGTCATTGGACAATTGGGGCGCTTTTGGGGTGGTTTCAGAAAGCAGGCG
AGTTTCTCATTGTCCACTAGGCCACTGTTTGTAGAGGTTATTCGAATACTCATCTGTCATTCAGAGCCAAACTGT
CCTTGAAACAGCCCGAAGAGACATCGGGGATGTTGTTACTCAGGCTCAGAAAGAACTCACGAAGCTAGCAAACAC
TGCTGCGGAGGAACCGAATACTGAACGAGAAACTCGGAGATCAAGTTCTAGAGAATACGAGGAAGAAGCTACACC
AATGTCGGCTTCCGTGTCGACCATTCAGGGAACAAGCTCAACTGATTCCTCTACTGAGTCCTCAGGTCATGCCAA
TGTCCAACCCCAACCTGGCTCGAACACTCAAACTCTTTTCTCTCGACTGCAATCCGCTCTTCCACCAAATGTCTT
ATCGACGGTACAGAACCATATTCCCGAATCAATTAAAAACGCATCTGAGAACGTCGACCTTACGCAAATTCGGAT
GAACCTATTGTCTGAGGTTCAAAGAATCCAGGGTGTAACAAGGGCACAAGCAGAGGAATATGCGCACAAGAGCGA
AGCATTGTTGCGAGAAGCCGTCAAAGAAGCGCAGGAGGTGTTTAAAGATGCTGTCAAGGTTATTCCCCCTGAGGG
TTCCAGCGCATCATCAGCCTCCGCGACATCTGGTCTCATCTGGGATGGTACGGACATGTGGACGTTGCCAGGAGT
CGCTGAAACGAACTCTGATGCTGCGGATGCGGATGCAAGTTCCGGGAAAGGTAAAGGGAAGAGCGTGGATTCTGG
AGCAGCTGCTGTGGCTACGAGGGCGGAAGCTTTGCTCAGAAGGTTAAAACACGATCCTGCTATTGTTCGGGTGGA
TCCCGGAGTAGATGGGACTACGAAAGACAAGTATACAGCGTGGATAAAGAATGAGGTTGTATCAAAAGGAGGTAT
TGCAGGCGAAGAATGGCGAACGGTAATTTCCAAGAGCTTGGACGACAGCATCGATGGTCAAGCTCTAACGAGTTT
GAAGGACGTGCTCGGTAAGTATTACTTCAAAAGTACGTCGTCCGATGTGTACGGGGAGCTCATGAAACTTTGTAT
TAGTTCCATCCGAGTTGGCTGAACAAGAATTTTGGCAACGTTTCTTCTTCCGCGTTCATCAGATCAAGGAGGAGG
AAGAAAAACGCAAAGCTCTATTACAAGGTCCGAGCTACCATCTTTATCCGGTTTTATGACCACTTATAATGTATA
ACTAGCTAATACCGAGAGTGAGGACGAATTTGATTGGGACGACGAAGATTCTGAGCATGAAGACGAAAACAAAGG
GGAAGTAACAAAAGAGGCAACACCTGCTCAAGACAAGGTACGCTGTATTCTTTCTCTTGATGTTGACAAAGCTGA
CTGCTCTTCTTAAAAGTCGATGGCAACAATCAATAACCCAGGTCTCGCACCTCCCTCTTCAACGACATCAACGAG
AGAAAGCAGCCTTGACAGCTTCGATGTCGTTTCTTCGGCAAATGCCAGTGTTTCTGGAGACAGACGTACTCAACA
TGTCAAAGCTGCCGAAAAAGACGATGATGAAGATGAAGATGAAGATGAAGATGACAGCGACTGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail