© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|047070 |
| Gene name | |
| Location | scaffold_2:2123212..2124021 |
| Strand | + |
| Gene length (bp) | 809 |
| Transcript length (bp) | 513 |
| Coding sequence length (bp) | 513 |
| Protein length (aa) | 171 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF05856 | ARPC4 | ARP2/3 complex 20 kDa subunit (ARPC4) | 1.8E-79 | 1 | 166 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P59999|ARPC4_MOUSE | Actin-related protein 2/3 complex subunit 4 OS=Mus musculus GN=Arpc4 PE=1 SV=3 | 1 | 165 | 4.0E-91 |
| sp|P59998|ARPC4_HUMAN | Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens GN=ARPC4 PE=1 SV=3 | 1 | 165 | 4.0E-91 |
| sp|Q148J6|ARPC4_BOVIN | Actin-related protein 2/3 complex subunit 4 OS=Bos taurus GN=ARPC4 PE=1 SV=3 | 1 | 165 | 4.0E-91 |
| sp|P58798|ARPC4_CAEEL | Probable actin-related protein 2/3 complex subunit 4 OS=Caenorhabditis elegans GN=arx-6 PE=3 SV=1 | 1 | 169 | 5.0E-90 |
| sp|Q92352|ARPC4_SCHPO | Actin-related protein 2/3 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc4 PE=1 SV=1 | 1 | 167 | 1.0E-83 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P59999|ARPC4_MOUSE | Actin-related protein 2/3 complex subunit 4 OS=Mus musculus GN=Arpc4 PE=1 SV=3 | 1 | 165 | 4.0E-91 |
| sp|P59998|ARPC4_HUMAN | Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens GN=ARPC4 PE=1 SV=3 | 1 | 165 | 4.0E-91 |
| sp|Q148J6|ARPC4_BOVIN | Actin-related protein 2/3 complex subunit 4 OS=Bos taurus GN=ARPC4 PE=1 SV=3 | 1 | 165 | 4.0E-91 |
| sp|P58798|ARPC4_CAEEL | Probable actin-related protein 2/3 complex subunit 4 OS=Caenorhabditis elegans GN=arx-6 PE=3 SV=1 | 1 | 169 | 5.0E-90 |
| sp|Q92352|ARPC4_SCHPO | Actin-related protein 2/3 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc4 PE=1 SV=1 | 1 | 167 | 1.0E-83 |
| sp|O96625|ARPC4_DICDI | Actin-related protein 2/3 complex subunit 4 OS=Dictyostelium discoideum GN=arcD PE=1 SV=1 | 1 | 165 | 1.0E-80 |
| sp|P33204|ARPC4_YEAST | Actin-related protein 2/3 complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC19 PE=1 SV=2 | 1 | 165 | 2.0E-79 |
| sp|F4JUL9|ARPC4_ARATH | Actin-related protein 2/3 complex subunit 4 OS=Arabidopsis thaliana GN=ARPC4 PE=1 SV=1 | 1 | 165 | 2.0E-69 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0034314 | Arp2/3 complex-mediated actin nucleation | Yes |
| GO:0030041 | actin filament polymerization | Yes |
| GO:0015629 | actin cytoskeleton | Yes |
| GO:0005885 | Arp2/3 protein complex | Yes |
| GO:0097435 | supramolecular fiber organization | No |
| GO:0007015 | actin filament organization | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0043933 | protein-containing complex organization | No |
| GO:0005575 | cellular_component | No |
| GO:0071840 | cellular component organization or biogenesis | No |
| GO:0008154 | actin polymerization or depolymerization | No |
| GO:0005856 | cytoskeleton | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:0008150 | biological_process | No |
| GO:0043229 | intracellular organelle | No |
| GO:0065003 | protein-containing complex assembly | No |
| GO:0051258 | protein polymerization | No |
| GO:0043226 | organelle | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0032991 | protein-containing complex | No |
| GO:0045010 | actin nucleation | No |
| GO:0009987 | cellular process | No |
| GO:0016043 | cellular component organization | No |
| GO:0022607 | cellular component assembly | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | Mitochondrial transit peptide | 0.5618 | 0.4387 | 0.1147 | 0.0691 | 0.4686 | 0.0404 | 0.0798 | 0.1257 | 0.1976 | 0.0404 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 364.20 | 218.52 | 509.87 |
| Initials | Initials knots | 279.89 | 168.13 | 391.65 |
| Pileal_Stipeal_center | Stage I stipe center | 261.93 | 157.02 | 366.84 |
| Pileal_Stipeal_shell | Stage I stipe shell | 142.51 | 81.92 | 203.10 |
| DIF_stipe_center | Stage II stipe center | 355.06 | 213.29 | 496.84 |
| DIF_stipe_shell | Stage II stipe shell | 356.39 | 214.04 | 498.73 |
| DIF_stipe_skin | Stage II stipe skin | 297.54 | 178.60 | 416.47 |
| DIF_cap_skin | Stage II cap skin | 122.53 | 69.91 | 175.15 |
| DIF_cap_tissue | Stage II cap tissue | 127.32 | 73.23 | 181.42 |
| DIF_gill_tissue | Stage II gill tissue | 159.28 | 93.04 | 225.52 |
| YFB_stipe_center | Young fruiting body stipe center | 395.07 | 235.86 | 554.29 |
| YFB_stipe_shell | Young fruiting body stipe shell | 456.75 | 272.82 | 640.68 |
| YFB_stipe_skin | Young fruiting body stipe skin | 374.29 | 222.43 | 526.14 |
| YFB_cap_skin | Young fruiting body cap skin | 200.67 | 119.02 | 282.32 |
| YFB_cap_tissue | Young fruiting body cap tissue | 167.02 | 97.67 | 236.38 |
| YFB_gill_tissue | Young fruiting body gill tissue | 188.42 | 110.37 | 266.47 |
| YFB_veil | Young fruiting body veil | 160.02 | 89.86 | 230.19 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.001140 | yes |
| Casing | YFB_stipe_center | 0.866045 | no |
| Casing | YFB_stipe_shell | 0.517309 | no |
| Casing | YFB_stipe_skin | 0.958258 | no |
| Casing | YFB_cap_skin | 0.019442 | yes |
| Casing | YFB_cap_tissue | 0.001140 | yes |
| Casing | YFB_gill_tissue | 0.009773 | yes |
| Casing | YFB_veil | 0.001140 | yes |
| Casing | Initials | 0.420923 | no |
| Casing | Pileal_Stipeal_center | 0.266969 | no |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.961619 | no |
| Casing | DIF_stipe_shell | 0.967333 | no |
| Casing | DIF_stipe_skin | 0.575388 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.530129 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.932602 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.685154 | no |
| DIF_gill_tissue | YFB_veil | 0.992564 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.730875 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.916575 | no |
| YFB_stipe_center | YFB_cap_skin | 0.006387 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.003365 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.592918 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.014956 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.001140 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.008791 | yes |
| YFB_stipe_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.642570 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.902583 | no |
| YFB_cap_skin | YFB_veil | 0.546582 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.790385 | no |
| YFB_cap_tissue | YFB_veil | 0.939543 | no |
| YFB_gill_tissue | YFB_veil | 0.705237 | no |
| Initials | DIF_gill_tissue | 0.032038 | yes |
| Initials | YFB_stipe_center | 0.256858 | no |
| Initials | YFB_stipe_shell | 0.064141 | no |
| Initials | YFB_stipe_skin | 0.362394 | no |
| Initials | YFB_cap_skin | 0.273950 | no |
| Initials | YFB_cap_tissue | 0.063183 | no |
| Initials | YFB_gill_tissue | 0.178712 | no |
| Initials | YFB_veil | 0.038942 | yes |
| Initials | Pileal_Stipeal_center | 0.895075 | no |
| Initials | Pileal_Stipeal_shell | 0.007782 | yes |
| Initials | DIF_stipe_center | 0.491552 | no |
| Initials | DIF_stipe_shell | 0.471702 | no |
| Initials | DIF_stipe_skin | 0.901508 | no |
| Initials | DIF_cap_skin | 0.001140 | yes |
| Initials | DIF_cap_tissue | 0.002084 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.071041 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.153005 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.033444 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.229034 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.421930 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.120057 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.289380 | no |
| Pileal_Stipeal_center | YFB_veil | 0.087755 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.023153 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.334715 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.318702 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.763896 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.003765 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.006032 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.818059 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.286712 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.715637 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.428730 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.811248 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.003765 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.733094 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.813716 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.002084 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.814616 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.452620 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.916935 | no |
| DIF_stipe_center | YFB_cap_skin | 0.027698 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.002525 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.012577 | yes |
| DIF_stipe_center | YFB_veil | 0.001625 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.993640 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.641922 | no |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.002084 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.825377 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.465248 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.924806 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.026215 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.002525 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.011350 | yes |
| DIF_stipe_shell | YFB_veil | 0.001625 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.634422 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.017507 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.385626 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.124995 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.506577 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.168405 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.034377 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.104906 | no |
| DIF_stipe_skin | YFB_veil | 0.022111 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.001625 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.456331 | no |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.080353 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.357460 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.152325 | no |
| DIF_cap_skin | YFB_veil | 0.465778 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.948073 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.556416 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.119615 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.450443 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.208910 | no |
| DIF_cap_tissue | YFB_veil | 0.560882 | no |
| Orthofinder run ID | 1 |
| Orthogroup | 3807 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|047070 |
| Agaricus bisporus var bisporus H97 | AgabiH97|047070 (this protein) |
| Rhodonia placenta FPRL280 | RhoplFPRL280|10_28 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|047070 MSNVLRPYLAAVRSTLTAALTLEDFSSQVVERHNKPEVETRASKEVLLNPLVISRNENERVLIEPSVNSIRLSIK IKQADEIERILCHKFTRFMMQRAENFVVLRRKPVPGYDISFLITNTHTETMLKHKIVDFIIQFMEEVDKEISEMK LSLNARARIVAESYLTAVNA* |
| Coding | >AgabiH97|047070 ATGTCAAACGTCTTGCGCCCATATCTCGCAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTT TCGTCCCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGAGCCTCAAAAGAAGTGCTCTTAAACCCC TTGGTCATCTCTCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAG ATCAAGCAAGCGGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAAC TTCGTTGTTCTAAGACGGAAGCCGGTCCCAGGCTATGATATATCTTTTTTGATCACAAACACCCATACAGAGACT ATGCTAAAGCACAAGATCGTCGATTTCATTATCCAATTCATGGAAGAGGTCGATAAAGAAATTAGTGAGATGAAA CTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTCAATGCATAG |
| Transcript | >AgabiH97|047070 ATGTCAAACGTCTTGCGCCCATATCTCGCAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTT TCGTCCCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGAGCCTCAAAAGAAGTGCTCTTAAACCCC TTGGTCATCTCTCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAG ATCAAGCAAGCGGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAAC TTCGTTGTTCTAAGACGGAAGCCGGTCCCAGGCTATGATATATCTTTTTTGATCACAAACACCCATACAGAGACT ATGCTAAAGCACAAGATCGTCGATTTCATTATCCAATTCATGGAAGAGGTCGATAAAGAAATTAGTGAGATGAAA CTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTCAATGCATAG |
| Gene | >AgabiH97|047070 ATGGTAAGTCCATCGATTATGCCATACTTCCGGTTGACAAAGCGCCGTAGTCAAACGTCTTGCGCCCATATCTCG CAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTTTCGTCCCAGGTGCGCAGATCGCTCGAGT TCACGAATCGGTCTCATCGTTCACCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGGTGCGTCTCA TTCTTTCGATCTCTTATTCGGCTAATGTCTGGCCAGAGCCTCAAAAGAAGTGCTCTTAAACCCCTTGGTCATCTC TCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAGATCAAGCAAGC GGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAACTTCGTTGTTCT AAGACGGAAGCCGGTCCCAGTCCGTCTTCATCCCTCCCCCCTTGGAAAATAACTCAATCCATAGTCCAGGGCTAT GATATATCTTTTTTGATCACAAACACCCATACAGAGACTATGCTAAAGCACAAGATCGTCGATTTCATTATCCAG TACGTGTCGTATTTCCAGTATATGCTTTGTTTCTCAATGTGGTCGCAACTTAGATTCATGGAAGAGGTCGATAAA GAAATTAGTGAGATGAAACTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTGTGT CATTTCATTCCTTCCAGCCTTGTTATGCCTCTCATTCTCGACTACAGGTCAATGCATAG |