Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047070
Gene name
Locationscaffold_2:2123212..2124021
Strand+
Gene length (bp)809
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05856 ARPC4 ARP2/3 complex 20 kDa subunit (ARPC4) 1.8E-79 1 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P59999|ARPC4_MOUSE Actin-related protein 2/3 complex subunit 4 OS=Mus musculus GN=Arpc4 PE=1 SV=3 1 165 4.0E-91
sp|P59998|ARPC4_HUMAN Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|Q148J6|ARPC4_BOVIN Actin-related protein 2/3 complex subunit 4 OS=Bos taurus GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|P58798|ARPC4_CAEEL Probable actin-related protein 2/3 complex subunit 4 OS=Caenorhabditis elegans GN=arx-6 PE=3 SV=1 1 169 5.0E-90
sp|Q92352|ARPC4_SCHPO Actin-related protein 2/3 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc4 PE=1 SV=1 1 167 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P59999|ARPC4_MOUSE Actin-related protein 2/3 complex subunit 4 OS=Mus musculus GN=Arpc4 PE=1 SV=3 1 165 4.0E-91
sp|P59998|ARPC4_HUMAN Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|Q148J6|ARPC4_BOVIN Actin-related protein 2/3 complex subunit 4 OS=Bos taurus GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|P58798|ARPC4_CAEEL Probable actin-related protein 2/3 complex subunit 4 OS=Caenorhabditis elegans GN=arx-6 PE=3 SV=1 1 169 5.0E-90
sp|Q92352|ARPC4_SCHPO Actin-related protein 2/3 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc4 PE=1 SV=1 1 167 1.0E-83
sp|O96625|ARPC4_DICDI Actin-related protein 2/3 complex subunit 4 OS=Dictyostelium discoideum GN=arcD PE=1 SV=1 1 165 1.0E-80
sp|P33204|ARPC4_YEAST Actin-related protein 2/3 complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC19 PE=1 SV=2 1 165 2.0E-79
sp|F4JUL9|ARPC4_ARATH Actin-related protein 2/3 complex subunit 4 OS=Arabidopsis thaliana GN=ARPC4 PE=1 SV=1 1 165 2.0E-69
[Show less]

GO

GO Term Description Terminal node
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0030041 actin filament polymerization Yes
GO:0015629 actin cytoskeleton Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0097435 supramolecular fiber organization No
GO:0007015 actin filament organization No
GO:0110165 cellular anatomical entity No
GO:0043933 protein-containing complex organization No
GO:0005575 cellular_component No
GO:0071840 cellular component organization or biogenesis No
GO:0008154 actin polymerization or depolymerization No
GO:0005856 cytoskeleton No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No
GO:0065003 protein-containing complex assembly No
GO:0051258 protein polymerization No
GO:0043226 organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0032991 protein-containing complex No
GO:0045010 actin nucleation No
GO:0009987 cellular process No
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 364.20 218.52 509.87
Initials Initials knots 279.89 168.13 391.65
Pileal_Stipeal_center Stage I stipe center 261.93 157.02 366.84
Pileal_Stipeal_shell Stage I stipe shell 142.51 81.92 203.10
DIF_stipe_center Stage II stipe center 355.06 213.29 496.84
DIF_stipe_shell Stage II stipe shell 356.39 214.04 498.73
DIF_stipe_skin Stage II stipe skin 297.54 178.60 416.47
DIF_cap_skin Stage II cap skin 122.53 69.91 175.15
DIF_cap_tissue Stage II cap tissue 127.32 73.23 181.42
DIF_gill_tissue Stage II gill tissue 159.28 93.04 225.52
YFB_stipe_center Young fruiting body stipe center 395.07 235.86 554.29
YFB_stipe_shell Young fruiting body stipe shell 456.75 272.82 640.68
YFB_stipe_skin Young fruiting body stipe skin 374.29 222.43 526.14
YFB_cap_skin Young fruiting body cap skin 200.67 119.02 282.32
YFB_cap_tissue Young fruiting body cap tissue 167.02 97.67 236.38
YFB_gill_tissue Young fruiting body gill tissue 188.42 110.37 266.47
YFB_veil Young fruiting body veil 160.02 89.86 230.19

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.001140 yes
Casing YFB_stipe_center 0.866045 no
Casing YFB_stipe_shell 0.517309 no
Casing YFB_stipe_skin 0.958258 no
Casing YFB_cap_skin 0.019442 yes
Casing YFB_cap_tissue 0.001140 yes
Casing YFB_gill_tissue 0.009773 yes
Casing YFB_veil 0.001140 yes
Casing Initials 0.420923 no
Casing Pileal_Stipeal_center 0.266969 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.961619 no
Casing DIF_stipe_shell 0.967333 no
Casing DIF_stipe_skin 0.575388 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.530129 no
DIF_gill_tissue YFB_cap_tissue 0.932602 no
DIF_gill_tissue YFB_gill_tissue 0.685154 no
DIF_gill_tissue YFB_veil 0.992564 no
YFB_stipe_center YFB_stipe_shell 0.730875 no
YFB_stipe_center YFB_stipe_skin 0.916575 no
YFB_stipe_center YFB_cap_skin 0.006387 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.003365 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.592918 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.014956 yes
YFB_stipe_skin YFB_cap_tissue 0.001140 yes
YFB_stipe_skin YFB_gill_tissue 0.008791 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.642570 no
YFB_cap_skin YFB_gill_tissue 0.902583 no
YFB_cap_skin YFB_veil 0.546582 no
YFB_cap_tissue YFB_gill_tissue 0.790385 no
YFB_cap_tissue YFB_veil 0.939543 no
YFB_gill_tissue YFB_veil 0.705237 no
Initials DIF_gill_tissue 0.032038 yes
Initials YFB_stipe_center 0.256858 no
Initials YFB_stipe_shell 0.064141 no
Initials YFB_stipe_skin 0.362394 no
Initials YFB_cap_skin 0.273950 no
Initials YFB_cap_tissue 0.063183 no
Initials YFB_gill_tissue 0.178712 no
Initials YFB_veil 0.038942 yes
Initials Pileal_Stipeal_center 0.895075 no
Initials Pileal_Stipeal_shell 0.007782 yes
Initials DIF_stipe_center 0.491552 no
Initials DIF_stipe_shell 0.471702 no
Initials DIF_stipe_skin 0.901508 no
Initials DIF_cap_skin 0.001140 yes
Initials DIF_cap_tissue 0.002084 yes
Pileal_Stipeal_center DIF_gill_tissue 0.071041 no
Pileal_Stipeal_center YFB_stipe_center 0.153005 no
Pileal_Stipeal_center YFB_stipe_shell 0.033444 yes
Pileal_Stipeal_center YFB_stipe_skin 0.229034 no
Pileal_Stipeal_center YFB_cap_skin 0.421930 no
Pileal_Stipeal_center YFB_cap_tissue 0.120057 no
Pileal_Stipeal_center YFB_gill_tissue 0.289380 no
Pileal_Stipeal_center YFB_veil 0.087755 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.023153 yes
Pileal_Stipeal_center DIF_stipe_center 0.334715 no
Pileal_Stipeal_center DIF_stipe_shell 0.318702 no
Pileal_Stipeal_center DIF_stipe_skin 0.763896 no
Pileal_Stipeal_center DIF_cap_skin 0.003765 yes
Pileal_Stipeal_center DIF_cap_tissue 0.006032 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.818059 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.286712 no
Pileal_Stipeal_shell YFB_cap_tissue 0.715637 no
Pileal_Stipeal_shell YFB_gill_tissue 0.428730 no
Pileal_Stipeal_shell YFB_veil 0.811248 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.003765 yes
Pileal_Stipeal_shell DIF_cap_skin 0.733094 no
Pileal_Stipeal_shell DIF_cap_tissue 0.813716 no
DIF_stipe_center DIF_gill_tissue 0.002084 yes
DIF_stipe_center YFB_stipe_center 0.814616 no
DIF_stipe_center YFB_stipe_shell 0.452620 no
DIF_stipe_center YFB_stipe_skin 0.916935 no
DIF_stipe_center YFB_cap_skin 0.027698 yes
DIF_stipe_center YFB_cap_tissue 0.002525 yes
DIF_stipe_center YFB_gill_tissue 0.012577 yes
DIF_stipe_center YFB_veil 0.001625 yes
DIF_stipe_center DIF_stipe_shell 0.993640 no
DIF_stipe_center DIF_stipe_skin 0.641922 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.002084 yes
DIF_stipe_shell YFB_stipe_center 0.825377 no
DIF_stipe_shell YFB_stipe_shell 0.465248 no
DIF_stipe_shell YFB_stipe_skin 0.924806 no
DIF_stipe_shell YFB_cap_skin 0.026215 yes
DIF_stipe_shell YFB_cap_tissue 0.002525 yes
DIF_stipe_shell YFB_gill_tissue 0.011350 yes
DIF_stipe_shell YFB_veil 0.001625 yes
DIF_stipe_shell DIF_stipe_skin 0.634422 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.017507 yes
DIF_stipe_skin YFB_stipe_center 0.385626 no
DIF_stipe_skin YFB_stipe_shell 0.124995 no
DIF_stipe_skin YFB_stipe_skin 0.506577 no
DIF_stipe_skin YFB_cap_skin 0.168405 no
DIF_stipe_skin YFB_cap_tissue 0.034377 yes
DIF_stipe_skin YFB_gill_tissue 0.104906 no
DIF_stipe_skin YFB_veil 0.022111 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.001625 yes
DIF_cap_skin DIF_gill_tissue 0.456331 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.080353 no
DIF_cap_skin YFB_cap_tissue 0.357460 no
DIF_cap_skin YFB_gill_tissue 0.152325 no
DIF_cap_skin YFB_veil 0.465778 no
DIF_cap_skin DIF_cap_tissue 0.948073 no
DIF_cap_tissue DIF_gill_tissue 0.556416 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.119615 no
DIF_cap_tissue YFB_cap_tissue 0.450443 no
DIF_cap_tissue YFB_gill_tissue 0.208910 no
DIF_cap_tissue YFB_veil 0.560882 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047070
MSNVLRPYLAAVRSTLTAALTLEDFSSQVVERHNKPEVETRASKEVLLNPLVISRNENERVLIEPSVNSIRLSIK
IKQADEIERILCHKFTRFMMQRAENFVVLRRKPVPGYDISFLITNTHTETMLKHKIVDFIIQFMEEVDKEISEMK
LSLNARARIVAESYLTAVNA*
Coding >AgabiH97|047070
ATGTCAAACGTCTTGCGCCCATATCTCGCAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTT
TCGTCCCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGAGCCTCAAAAGAAGTGCTCTTAAACCCC
TTGGTCATCTCTCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAG
ATCAAGCAAGCGGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAAC
TTCGTTGTTCTAAGACGGAAGCCGGTCCCAGGCTATGATATATCTTTTTTGATCACAAACACCCATACAGAGACT
ATGCTAAAGCACAAGATCGTCGATTTCATTATCCAATTCATGGAAGAGGTCGATAAAGAAATTAGTGAGATGAAA
CTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTCAATGCATAG
Transcript >AgabiH97|047070
ATGTCAAACGTCTTGCGCCCATATCTCGCAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTT
TCGTCCCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGAGCCTCAAAAGAAGTGCTCTTAAACCCC
TTGGTCATCTCTCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAG
ATCAAGCAAGCGGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAAC
TTCGTTGTTCTAAGACGGAAGCCGGTCCCAGGCTATGATATATCTTTTTTGATCACAAACACCCATACAGAGACT
ATGCTAAAGCACAAGATCGTCGATTTCATTATCCAATTCATGGAAGAGGTCGATAAAGAAATTAGTGAGATGAAA
CTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTCAATGCATAG
Gene >AgabiH97|047070
ATGGTAAGTCCATCGATTATGCCATACTTCCGGTTGACAAAGCGCCGTAGTCAAACGTCTTGCGCCCATATCTCG
CAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTTTCGTCCCAGGTGCGCAGATCGCTCGAGT
TCACGAATCGGTCTCATCGTTCACCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGGTGCGTCTCA
TTCTTTCGATCTCTTATTCGGCTAATGTCTGGCCAGAGCCTCAAAAGAAGTGCTCTTAAACCCCTTGGTCATCTC
TCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAGATCAAGCAAGC
GGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAACTTCGTTGTTCT
AAGACGGAAGCCGGTCCCAGTCCGTCTTCATCCCTCCCCCCTTGGAAAATAACTCAATCCATAGTCCAGGGCTAT
GATATATCTTTTTTGATCACAAACACCCATACAGAGACTATGCTAAAGCACAAGATCGTCGATTTCATTATCCAG
TACGTGTCGTATTTCCAGTATATGCTTTGTTTCTCAATGTGGTCGCAACTTAGATTCATGGAAGAGGTCGATAAA
GAAATTAGTGAGATGAAACTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTGTGT
CATTTCATTCCTTCCAGCCTTGTTATGCCTCTCATTCTCGACTACAGGTCAATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail