Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047070
Gene name
Locationscaffold_2:2123212..2124021
Strand+
Gene length (bp)809
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05856 ARPC4 ARP2/3 complex 20 kDa subunit (ARPC4) 1.8E-79 1 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P59999|ARPC4_MOUSE Actin-related protein 2/3 complex subunit 4 OS=Mus musculus GN=Arpc4 PE=1 SV=3 1 165 4.0E-91
sp|P59998|ARPC4_HUMAN Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|Q148J6|ARPC4_BOVIN Actin-related protein 2/3 complex subunit 4 OS=Bos taurus GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|P58798|ARPC4_CAEEL Probable actin-related protein 2/3 complex subunit 4 OS=Caenorhabditis elegans GN=arx-6 PE=3 SV=1 1 169 5.0E-90
sp|Q92352|ARPC4_SCHPO Actin-related protein 2/3 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc4 PE=1 SV=1 1 167 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P59999|ARPC4_MOUSE Actin-related protein 2/3 complex subunit 4 OS=Mus musculus GN=Arpc4 PE=1 SV=3 1 165 4.0E-91
sp|P59998|ARPC4_HUMAN Actin-related protein 2/3 complex subunit 4 OS=Homo sapiens GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|Q148J6|ARPC4_BOVIN Actin-related protein 2/3 complex subunit 4 OS=Bos taurus GN=ARPC4 PE=1 SV=3 1 165 4.0E-91
sp|P58798|ARPC4_CAEEL Probable actin-related protein 2/3 complex subunit 4 OS=Caenorhabditis elegans GN=arx-6 PE=3 SV=1 1 169 5.0E-90
sp|Q92352|ARPC4_SCHPO Actin-related protein 2/3 complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arc4 PE=1 SV=1 1 167 1.0E-83
sp|O96625|ARPC4_DICDI Actin-related protein 2/3 complex subunit 4 OS=Dictyostelium discoideum GN=arcD PE=1 SV=1 1 165 1.0E-80
sp|P33204|ARPC4_YEAST Actin-related protein 2/3 complex subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC19 PE=1 SV=2 1 165 2.0E-79
sp|F4JUL9|ARPC4_ARATH Actin-related protein 2/3 complex subunit 4 OS=Arabidopsis thaliana GN=ARPC4 PE=1 SV=1 1 165 2.0E-69
[Show less]

GO

GO Term Description Terminal node
GO:0034314 Arp2/3 complex-mediated actin nucleation Yes
GO:0030041 actin filament polymerization Yes
GO:0015629 actin cytoskeleton Yes
GO:0005885 Arp2/3 protein complex Yes
GO:0097435 supramolecular fiber organization No
GO:0007015 actin filament organization No
GO:0110165 cellular anatomical entity No
GO:0043933 protein-containing complex organization No
GO:0005575 cellular_component No
GO:0071840 cellular component organization or biogenesis No
GO:0008154 actin polymerization or depolymerization No
GO:0005856 cytoskeleton No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No
GO:0065003 protein-containing complex assembly No
GO:0051258 protein polymerization No
GO:0043226 organelle No
GO:0043228 non-membrane-bounded organelle No
GO:0032991 protein-containing complex No
GO:0045010 actin nucleation No
GO:0009987 cellular process No
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047070
MSNVLRPYLAAVRSTLTAALTLEDFSSQVVERHNKPEVETRASKEVLLNPLVISRNENERVLIEPSVNSIRLSIK
IKQADEIERILCHKFTRFMMQRAENFVVLRRKPVPGYDISFLITNTHTETMLKHKIVDFIIQFMEEVDKEISEMK
LSLNARARIVAESYLTAVNA*
Coding >AgabiH97|047070
ATGTCAAACGTCTTGCGCCCATATCTCGCAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTT
TCGTCCCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGAGCCTCAAAAGAAGTGCTCTTAAACCCC
TTGGTCATCTCTCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAG
ATCAAGCAAGCGGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAAC
TTCGTTGTTCTAAGACGGAAGCCGGTCCCAGGCTATGATATATCTTTTTTGATCACAAACACCCATACAGAGACT
ATGCTAAAGCACAAGATCGTCGATTTCATTATCCAATTCATGGAAGAGGTCGATAAAGAAATTAGTGAGATGAAA
CTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTCAATGCATAG
Transcript >AgabiH97|047070
ATGTCAAACGTCTTGCGCCCATATCTCGCAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTT
TCGTCCCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGAGCCTCAAAAGAAGTGCTCTTAAACCCC
TTGGTCATCTCTCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAG
ATCAAGCAAGCGGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAAC
TTCGTTGTTCTAAGACGGAAGCCGGTCCCAGGCTATGATATATCTTTTTTGATCACAAACACCCATACAGAGACT
ATGCTAAAGCACAAGATCGTCGATTTCATTATCCAATTCATGGAAGAGGTCGATAAAGAAATTAGTGAGATGAAA
CTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTCAATGCATAG
Gene >AgabiH97|047070
ATGGTAAGTCCATCGATTATGCCATACTTCCGGTTGACAAAGCGCCGTAGTCAAACGTCTTGCGCCCATATCTCG
CAGCAGTCCGGTCCACGCTGACCGCAGCATTGACCCTTGAGGACTTTTCGTCCCAGGTGCGCAGATCGCTCGAGT
TCACGAATCGGTCTCATCGTTCACCAGGTAGTTGAACGCCACAACAAACCAGAAGTAGAAACGAGGTGCGTCTCA
TTCTTTCGATCTCTTATTCGGCTAATGTCTGGCCAGAGCCTCAAAAGAAGTGCTCTTAAACCCCTTGGTCATCTC
TCGTAACGAGAACGAAAGAGTTCTGATCGAGCCGTCCGTGAATTCCATTAGGCTGAGCATTAAGATCAAGCAAGC
GGACGAAATCGAACGTATTCTTTGTCACAAATTCACCAGATTTATGATGCAGCGAGCCGAGAACTTCGTTGTTCT
AAGACGGAAGCCGGTCCCAGTCCGTCTTCATCCCTCCCCCCTTGGAAAATAACTCAATCCATAGTCCAGGGCTAT
GATATATCTTTTTTGATCACAAACACCCATACAGAGACTATGCTAAAGCACAAGATCGTCGATTTCATTATCCAG
TACGTGTCGTATTTCCAGTATATGCTTTGTTTCTCAATGTGGTCGCAACTTAGATTCATGGAAGAGGTCGATAAA
GAAATTAGTGAGATGAAACTTAGTCTGAACGCTCGAGCACGTATAGTTGCGGAGTCTTATCTGACTGCGGTGTGT
CATTTCATTCCTTCCAGCCTTGTTATGCCTCTCATTCTCGACTACAGGTCAATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail