Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|047000
Gene name
Locationscaffold_2:2104708..2105722
Strand+
Gene length (bp)1014
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 2.1E-16 165 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G5|BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bos1 PE=3 SV=1 2 252 2.0E-42
sp|Q6BZQ6|BOS1_YARLI Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 1 252 3.0E-26
sp|Q6BVM4|BOS1_DEBHA Protein transport protein BOS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BOS1 PE=3 SV=1 1 252 2.0E-19
sp|O35166|GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus GN=Gosr2 PE=1 SV=2 1 252 3.0E-18
sp|O35165|GOSR2_RAT Golgi SNAP receptor complex member 2 OS=Rattus norvegicus GN=Gosr2 PE=1 SV=2 1 252 9.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7G5|BOS1_SCHPO Protein transport protein bos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bos1 PE=3 SV=1 2 252 2.0E-42
sp|Q6BZQ6|BOS1_YARLI Protein transport protein BOS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BOS1 PE=3 SV=1 1 252 3.0E-26
sp|Q6BVM4|BOS1_DEBHA Protein transport protein BOS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BOS1 PE=3 SV=1 1 252 2.0E-19
sp|O35166|GOSR2_MOUSE Golgi SNAP receptor complex member 2 OS=Mus musculus GN=Gosr2 PE=1 SV=2 1 252 3.0E-18
sp|O35165|GOSR2_RAT Golgi SNAP receptor complex member 2 OS=Rattus norvegicus GN=Gosr2 PE=1 SV=2 1 252 9.0E-16
sp|O14653|GOSR2_HUMAN Golgi SNAP receptor complex member 2 OS=Homo sapiens GN=GOSR2 PE=1 SV=2 171 252 7.0E-14
sp|Q75CY3|BOS1_ASHGO Protein transport protein BOS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BOS1 PE=3 SV=2 1 253 4.0E-13
sp|P25385|BOS1_YEAST Protein transport protein BOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BOS1 PE=1 SV=1 1 234 4.0E-13
sp|Q6FKA1|BOS1_CANGA Protein transport protein BOS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BOS1 PE=3 SV=1 1 252 7.0E-13
sp|Q9VRL2|GOSR2_DROME Probable Golgi SNAP receptor complex member 2 OS=Drosophila melanogaster GN=Membrin PE=2 SV=1 151 252 2.0E-12
sp|A8XP14|GOSR2_CAEBR Probable Golgi SNAP receptor complex member 2 OS=Caenorhabditis briggsae GN=gosr-2.1 PE=3 SV=1 1 249 8.0E-10
sp|Q9SJL6|MEM11_ARATH Membrin-11 OS=Arabidopsis thaliana GN=MEMB11 PE=1 SV=1 158 247 2.0E-08
sp|Q9FK28|MEM12_ARATH Membrin-12 OS=Arabidopsis thaliana GN=MEMB12 PE=2 SV=1 171 247 4.0E-07
sp|Q6CRX0|BOS1_KLULA Protein transport protein BOS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BOS1 PE=3 SV=1 1 230 8.0E-07
sp|P41941|GOSR2_CAEEL Probable Golgi SNAP receptor complex member 2 OS=Caenorhabditis elegans GN=gosr-2.1 PE=3 SV=1 1 249 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1262 0.158 0.0399 0.0535 0.2124 0.0052 0.5131 0.4498 0.6682 0.0265

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 233 252 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 55.50 30.55 80.44
Initials Initials knots 37.79 20.33 55.24
Pileal_Stipeal_center Stage I stipe center 64.93 36.93 92.92
Pileal_Stipeal_shell Stage I stipe shell 85.29 49.47 121.12
DIF_stipe_center Stage II stipe center 66.50 38.21 94.79
DIF_stipe_shell Stage II stipe shell 69.50 40.13 98.88
DIF_stipe_skin Stage II stipe skin 66.35 38.11 94.59
DIF_cap_skin Stage II cap skin 101.11 60.04 142.18
DIF_cap_tissue Stage II cap tissue 90.12 52.64 127.60
DIF_gill_tissue Stage II gill tissue 90.21 53.24 127.18
YFB_stipe_center Young fruiting body stipe center 60.02 33.83 86.20
YFB_stipe_shell Young fruiting body stipe shell 67.45 38.72 96.18
YFB_stipe_skin Young fruiting body stipe skin 79.19 46.19 112.20
YFB_cap_skin Young fruiting body cap skin 114.21 68.05 160.36
YFB_cap_tissue Young fruiting body cap tissue 90.35 53.26 127.45
YFB_gill_tissue Young fruiting body gill tissue 101.78 60.41 143.15
YFB_veil Young fruiting body veil 89.97 53.17 126.77

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.101542 no
Casing YFB_stipe_center 0.886799 no
Casing YFB_stipe_shell 0.649677 no
Casing YFB_stipe_skin 0.287891 no
Casing YFB_cap_skin 0.009446 yes
Casing YFB_cap_tissue 0.100086 no
Casing YFB_gill_tissue 0.032742 yes
Casing YFB_veil 0.100086 no
Casing Initials 0.276147 no
Casing Pileal_Stipeal_center 0.726582 no
Casing Pileal_Stipeal_shell 0.165288 no
Casing DIF_stipe_center 0.680313 no
Casing DIF_stipe_shell 0.577809 no
Casing DIF_stipe_skin 0.686487 no
Casing DIF_cap_skin 0.033674 yes
Casing DIF_cap_tissue 0.109462 no
DIF_gill_tissue YFB_stipe_center 0.188034 no
DIF_gill_tissue YFB_stipe_shell 0.392751 no
DIF_gill_tissue YFB_stipe_skin 0.767485 no
DIF_gill_tissue YFB_cap_skin 0.502692 no
DIF_gill_tissue YFB_cap_tissue 0.997541 no
DIF_gill_tissue YFB_gill_tissue 0.783132 no
DIF_gill_tissue YFB_veil 0.995961 no
YFB_stipe_center YFB_stipe_shell 0.810817 no
YFB_stipe_center YFB_stipe_skin 0.442195 no
YFB_stipe_center YFB_cap_skin 0.019715 yes
YFB_stipe_center YFB_cap_tissue 0.186551 no
YFB_stipe_center YFB_gill_tissue 0.067147 no
YFB_stipe_center YFB_veil 0.190735 no
YFB_stipe_shell YFB_stipe_skin 0.707042 no
YFB_stipe_shell YFB_cap_skin 0.058347 no
YFB_stipe_shell YFB_cap_tissue 0.385853 no
YFB_stipe_shell YFB_gill_tissue 0.175675 no
YFB_stipe_shell YFB_veil 0.392751 no
YFB_stipe_skin YFB_cap_skin 0.226605 no
YFB_stipe_skin YFB_cap_tissue 0.767760 no
YFB_stipe_skin YFB_gill_tissue 0.478128 no
YFB_stipe_skin YFB_veil 0.776502 no
YFB_cap_skin YFB_cap_tissue 0.511942 no
YFB_cap_skin YFB_gill_tissue 0.796153 no
YFB_cap_skin YFB_veil 0.498596 no
YFB_cap_tissue YFB_gill_tissue 0.783580 no
YFB_cap_tissue YFB_veil 0.993530 no
YFB_gill_tissue YFB_veil 0.779392 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.152465 no
Initials YFB_stipe_shell 0.049046 yes
Initials YFB_stipe_skin 0.007782 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.075556 no
Initials Pileal_Stipeal_shell 0.004160 yes
Initials DIF_stipe_center 0.058147 no
Initials DIF_stipe_shell 0.041824 yes
Initials DIF_stipe_skin 0.059906 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.002084 yes
Pileal_Stipeal_center DIF_gill_tissue 0.302600 no
Pileal_Stipeal_center YFB_stipe_center 0.880651 no
Pileal_Stipeal_center YFB_stipe_shell 0.945928 no
Pileal_Stipeal_center YFB_stipe_skin 0.611770 no
Pileal_Stipeal_center YFB_cap_skin 0.040947 yes
Pileal_Stipeal_center YFB_cap_tissue 0.298605 no
Pileal_Stipeal_center YFB_gill_tissue 0.124559 no
Pileal_Stipeal_center YFB_veil 0.309722 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.441434 no
Pileal_Stipeal_center DIF_stipe_center 0.968057 no
Pileal_Stipeal_center DIF_stipe_shell 0.895377 no
Pileal_Stipeal_center DIF_stipe_skin 0.970603 no
Pileal_Stipeal_center DIF_cap_skin 0.124703 no
Pileal_Stipeal_center DIF_cap_tissue 0.319333 no
Pileal_Stipeal_shell DIF_gill_tissue 0.915831 no
Pileal_Stipeal_shell YFB_stipe_center 0.282501 no
Pileal_Stipeal_shell YFB_stipe_shell 0.524273 no
Pileal_Stipeal_shell YFB_stipe_skin 0.886118 no
Pileal_Stipeal_shell YFB_cap_skin 0.371148 no
Pileal_Stipeal_shell YFB_cap_tissue 0.913319 no
Pileal_Stipeal_shell YFB_gill_tissue 0.650250 no
Pileal_Stipeal_shell YFB_veil 0.919591 no
Pileal_Stipeal_shell DIF_stipe_center 0.491424 no
Pileal_Stipeal_shell DIF_stipe_shell 0.594019 no
Pileal_Stipeal_shell DIF_stipe_skin 0.486243 no
Pileal_Stipeal_shell DIF_cap_skin 0.671439 no
Pileal_Stipeal_shell DIF_cap_tissue 0.918427 no
DIF_stipe_center DIF_gill_tissue 0.357977 no
DIF_stipe_center YFB_stipe_center 0.838842 no
DIF_stipe_center YFB_stipe_shell 0.980912 no
DIF_stipe_center YFB_stipe_skin 0.672696 no
DIF_stipe_center YFB_cap_skin 0.056367 no
DIF_stipe_center YFB_cap_tissue 0.356796 no
DIF_stipe_center YFB_gill_tissue 0.158909 no
DIF_stipe_center YFB_veil 0.364513 no
DIF_stipe_center DIF_stipe_shell 0.937412 no
DIF_stipe_center DIF_stipe_skin 0.996005 no
DIF_stipe_center DIF_cap_skin 0.162096 no
DIF_stipe_center DIF_cap_tissue 0.376714 no
DIF_stipe_shell DIF_gill_tissue 0.461733 no
DIF_stipe_shell YFB_stipe_center 0.747944 no
DIF_stipe_shell YFB_stipe_shell 0.958111 no
DIF_stipe_shell YFB_stipe_skin 0.775042 no
DIF_stipe_shell YFB_cap_skin 0.077879 no
DIF_stipe_shell YFB_cap_tissue 0.456864 no
DIF_stipe_shell YFB_gill_tissue 0.214476 no
DIF_stipe_shell YFB_veil 0.463390 no
DIF_stipe_shell DIF_stipe_skin 0.934295 no
DIF_stipe_shell DIF_cap_skin 0.222148 no
DIF_stipe_shell DIF_cap_tissue 0.474959 no
DIF_stipe_skin DIF_gill_tissue 0.350907 no
DIF_stipe_skin YFB_stipe_center 0.840425 no
DIF_stipe_skin YFB_stipe_shell 0.977194 no
DIF_stipe_skin YFB_stipe_skin 0.664695 no
DIF_stipe_skin YFB_cap_skin 0.048007 yes
DIF_stipe_skin YFB_cap_tissue 0.349136 no
DIF_stipe_skin YFB_gill_tissue 0.146718 no
DIF_stipe_skin YFB_veil 0.357201 no
DIF_stipe_skin DIF_cap_skin 0.149346 no
DIF_stipe_skin DIF_cap_tissue 0.369619 no
DIF_cap_skin DIF_gill_tissue 0.799973 no
DIF_cap_skin YFB_stipe_center 0.074840 no
DIF_cap_skin YFB_stipe_shell 0.177697 no
DIF_cap_skin YFB_stipe_skin 0.489051 no
DIF_cap_skin YFB_cap_skin 0.781875 no
DIF_cap_skin YFB_cap_tissue 0.802427 no
DIF_cap_skin YFB_gill_tissue 0.990059 no
DIF_cap_skin YFB_veil 0.792498 no
DIF_cap_skin DIF_cap_tissue 0.802334 no
DIF_cap_tissue DIF_gill_tissue 0.997956 no
DIF_cap_tissue YFB_stipe_center 0.195445 no
DIF_cap_tissue YFB_stipe_shell 0.408200 no
DIF_cap_tissue YFB_stipe_skin 0.776020 no
DIF_cap_tissue YFB_cap_skin 0.511055 no
DIF_cap_tissue YFB_cap_tissue 0.995589 no
DIF_cap_tissue YFB_gill_tissue 0.785747 no
DIF_cap_tissue YFB_veil 0.997161 no

Orthologs

Orthofinder run ID1
Orthogroup5754
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|047000
Agaricus bisporus var bisporus H97 AgabiH97|047000 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|142_20

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|047000
MNSLYTSGVRQTTSLQADLERLRNGDVSASLLGQISASLAAMSRTIDDYDAMAKREIIKAKQEKAQMRVQKFRLD
YSEFRIQFEKLKADVLEQQSTSQRAELISSSATSNTTTPTSDTRRRFQTTPGPSTLHPGLRPSNTSDTISESPFR
SSSPYGNYGQESRALDEHTFIHNTDSKLDEFLAQGREVLDNLVDQRKMLKGTRKRLLDAANTLGLSRQVIGWIER
RSTQDTYIFGGGAVFTFFCFYLIWHYFG*
Coding >AgabiH97|047000
ATGAACTCTCTATACACATCTGGTGTACGACAAACAACATCTCTTCAAGCCGACCTCGAGCGTCTACGGAATGGG
GACGTTTCCGCCTCACTCCTTGGACAGATATCGGCTTCTCTAGCGGCTATGAGTCGGACTATAGACGACTATGAT
GCAATGGCCAAACGAGAGATTATTAAAGCCAAACAGGAAAAGGCGCAAATGCGTGTGCAGAAATTTCGGTTGGAT
TATTCAGAGTTTCGGATTCAGTTTGAGAAACTCAAGGCGGATGTATTGGAACAGCAATCAACTTCTCAACGGGCG
GAACTCATCTCAAGTTCGGCGACTTCAAATACTACTACTCCTACATCCGACACACGACGACGTTTCCAAACGACA
CCAGGACCTTCAACACTTCATCCCGGTCTCCGACCTTCCAACACCTCCGATACCATTTCAGAATCCCCCTTCCGT
TCTTCATCACCTTATGGCAATTATGGTCAAGAGTCCCGCGCCTTGGACGAACATACTTTCATCCACAATACAGAT
AGCAAACTAGATGAGTTCTTAGCGCAGGGAAGGGAAGTGTTGGATAATTTGGTGGATCAGAGGAAGATGTTGAAG
GGGACTCGTAAACGACTGTTGGATGCTGCGAACACTCTTGGGTTGAGTCGACAAGTAATTGGATGGATTGAAAGA
CGAAGTACGCAAGACACGTATATCTTCGGAGGAGGAGCCGTTTTCACATTCTTCTGTTTCTATCTCATATGGCAC
TATTTCGGTTAA
Transcript >AgabiH97|047000
ATGAACTCTCTATACACATCTGGTGTACGACAAACAACATCTCTTCAAGCCGACCTCGAGCGTCTACGGAATGGG
GACGTTTCCGCCTCACTCCTTGGACAGATATCGGCTTCTCTAGCGGCTATGAGTCGGACTATAGACGACTATGAT
GCAATGGCCAAACGAGAGATTATTAAAGCCAAACAGGAAAAGGCGCAAATGCGTGTGCAGAAATTTCGGTTGGAT
TATTCAGAGTTTCGGATTCAGTTTGAGAAACTCAAGGCGGATGTATTGGAACAGCAATCAACTTCTCAACGGGCG
GAACTCATCTCAAGTTCGGCGACTTCAAATACTACTACTCCTACATCCGACACACGACGACGTTTCCAAACGACA
CCAGGACCTTCAACACTTCATCCCGGTCTCCGACCTTCCAACACCTCCGATACCATTTCAGAATCCCCCTTCCGT
TCTTCATCACCTTATGGCAATTATGGTCAAGAGTCCCGCGCCTTGGACGAACATACTTTCATCCACAATACAGAT
AGCAAACTAGATGAGTTCTTAGCGCAGGGAAGGGAAGTGTTGGATAATTTGGTGGATCAGAGGAAGATGTTGAAG
GGGACTCGTAAACGACTGTTGGATGCTGCGAACACTCTTGGGTTGAGTCGACAAGTAATTGGATGGATTGAAAGA
CGAAGTACGCAAGACACGTATATCTTCGGAGGAGGAGCCGTTTTCACATTCTTCTGTTTCTATCTCATATGGCAC
TATTTCGGTTAA
Gene >AgabiH97|047000
ATGAACTCTCTATACACATCTGGTGTACGACAAACAACATCTCTTCAAGCCGACCTCGAGCGTCTACGGAATGGG
GACGTTTCCGCCTCACTCCTTGGTGCGTAGCCCATTTCATACCCATGCATCGTATAGCAGCGGTGGTCATATTTA
TTTTGTTTTGTTTTGTTTTTGTTAGGACAGATATCGGCTTCTCTAGCGGCTATGAGTCGGACTATAGACGACTAT
GATGCAATGGCCAAACGAGAGATTATTAAAGCCAAACAGGAAAAGGCGCAAATGTGCGCAGTAACTCCAATTCTT
TGCAGTTAAGAGAAAAGATTAAAATGGAAAGCGTATAGGCGTGTGCAGAAATTTCGGTTGGATTATTCAGAGTTT
CGGATTCAGTTTGAGAAACTCAAGGCGGATGTATTGGAACAGGTGAGTTCTTTTTGTGTTGCACGAGTAGCTTTA
TGGAAACCTATGCGTCTGCATAAAAGCAATCAACTTCTCAACGGGCGGAACTCATCTCAAGTTCGGCGACTTCAA
ATACTACTACTCCTACATCCGACACACGACGACGTTTCCAAACGACACCAGGACCTTCAACACTTCATCCCGGTC
TCCGACCTTCCAACACCTCCGATACCATTTCAGAATCCCCCTTCCGTTCTTCATCACCTTATGGCAATTATGGTC
AAGAGTCCCGCGCCTTGGACGAACATACTTTCATCCACAATACAGATAGCAAACTAGATGAGTTCTTAGCGCAGG
GAAGGGAAGTGTTGGATAATTTGGTGGATCAGAGGAAGATGTTGAAGGGGACTCGTAAACGACTGTTGGATGCTG
CGAACACTCTTGGGTTGAGTCGACAAGTAATTGGATGGATTGAAAGACGAAGGTGCATTTTCCATTATCACTTTT
CCCTAAAGCACGCCCTAAAAACTGTTGTTCAGTACGCAAGACACGTATATCTTCGGAGGAGGAGCCGTTTTCACA
TTCTTCTGTTTCTATCTCATATGGCACTATTTCGGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail