Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046770
Gene name
Locationscaffold_2:2036510..2038287
Strand-
Gene length (bp)1777
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 5.8E-44 148 370
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 4.0E-08 405 456

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08970|MMT2_YEAST Mitochondrial metal transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT2 PE=3 SV=2 139 455 3.0E-41
sp|O59758|YJM3_SCHPO Uncharacterized metal transporter C1020.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.03 PE=3 SV=1 107 451 2.0E-40
sp|Q8L725|MTPC1_ARATH Metal tolerance protein C1 OS=Arabidopsis thaliana GN=MTPC1 PE=2 SV=1 141 463 2.0E-38
sp|Q10LJ2|MTP2_ORYSJ Metal tolerance protein 2 OS=Oryza sativa subsp. japonica GN=MTP2 PE=2 SV=1 149 463 3.0E-37
sp|Q03218|MMT1_YEAST Mitochondrial metal transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT1 PE=1 SV=1 128 428 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08970|MMT2_YEAST Mitochondrial metal transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT2 PE=3 SV=2 139 455 3.0E-41
sp|O59758|YJM3_SCHPO Uncharacterized metal transporter C1020.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.03 PE=3 SV=1 107 451 2.0E-40
sp|Q8L725|MTPC1_ARATH Metal tolerance protein C1 OS=Arabidopsis thaliana GN=MTPC1 PE=2 SV=1 141 463 2.0E-38
sp|Q10LJ2|MTP2_ORYSJ Metal tolerance protein 2 OS=Oryza sativa subsp. japonica GN=MTP2 PE=2 SV=1 149 463 3.0E-37
sp|Q03218|MMT1_YEAST Mitochondrial metal transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMT1 PE=1 SV=1 128 428 2.0E-32
sp|P46348|YEAB_BACSU Uncharacterized transporter YeaB OS=Bacillus subtilis (strain 168) GN=yeaB PE=3 SV=2 138 450 9.0E-19
sp|P96610|YDBO_BACSU Uncharacterized transporter YdbO OS=Bacillus subtilis (strain 168) GN=ydbO PE=3 SV=1 142 445 2.0E-16
sp|Q57891|Y449_METJA Uncharacterized transporter MJ0449 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0449 PE=3 SV=1 148 449 6.0E-13
sp|C0SP78|YDFM_BACSU Uncharacterized transporter YdfM OS=Bacillus subtilis (strain 168) GN=ydfM PE=3 SV=1 146 459 2.0E-12
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 140 433 2.0E-11
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 149 367 7.0E-08
sp|B2JZA2|FIEF_YERPB Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|B7LVD0|FIEF_ESCF3 Ferrous-iron efflux pump FieF OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|Q1C296|FIEF_YERPA Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|Q8ZJL7|FIEF_YERPE Cation-efflux pump FieF OS=Yersinia pestis GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|Q1CD32|FIEF_YERPN Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|A9R6A2|FIEF_YERPG Cation-efflux pump FieF OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|A4TSA8|FIEF_YERPP Cation-efflux pump FieF OS=Yersinia pestis (strain Pestoides F) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|Q66GA9|FIEF_YERPS Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|B1JQU5|FIEF_YERPY Cation-efflux pump FieF OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fieF PE=3 SV=1 156 448 9.0E-08
sp|Q31U75|FIEF_SHIBS Cation-efflux pump FieF OS=Shigella boydii serotype 4 (strain Sb227) GN=fieF PE=3 SV=1 156 448 2.0E-07
sp|B2TVQ7|FIEF_SHIB3 Cation-efflux pump FieF OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fieF PE=3 SV=1 156 448 2.0E-07
sp|A7ZUC8|FIEF_ECO24 Ferrous-iron efflux pump FieF OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|Q3YV63|FIEF_SHISS Cation-efflux pump FieF OS=Shigella sonnei (strain Ss046) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|Q83PD6|FIEF_SHIFL Cation-efflux pump FieF OS=Shigella flexneri GN=fieF PE=3 SV=2 156 448 3.0E-07
sp|B1LNL8|FIEF_ECOSM Ferrous-iron efflux pump FieF OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|Q8FBD1|FIEF_ECOL6 Ferrous-iron efflux pump FieF OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fieF PE=3 SV=2 156 448 3.0E-07
sp|Q0TAE9|FIEF_ECOL5 Ferrous-iron efflux pump FieF OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|A1AI91|FIEF_ECOK1 Ferrous-iron efflux pump FieF OS=Escherichia coli O1:K1 / APEC GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7N2Q6|FIEF_ECO81 Ferrous-iron efflux pump FieF OS=Escherichia coli O81 (strain ED1a) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7NU92|FIEF_ECO7I Ferrous-iron efflux pump FieF OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7MI47|FIEF_ECO45 Ferrous-iron efflux pump FieF OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7UNN5|FIEF_ECO27 Ferrous-iron efflux pump FieF OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|P69381|FIEF_ECO57 Ferrous-iron efflux pump FieF OS=Escherichia coli O157:H7 GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B5YZ52|FIEF_ECO5E Ferrous-iron efflux pump FieF OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7LA12|FIEF_ECO55 Ferrous-iron efflux pump FieF OS=Escherichia coli (strain 55989 / EAEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|Q32A79|FIEF_SHIDS Cation-efflux pump FieF OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B6I4Q7|FIEF_ECOSE Ferrous-iron efflux pump FieF OS=Escherichia coli (strain SE11) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7NFL2|FIEF_ECOLU Ferrous-iron efflux pump FieF OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|P69380|FIEF_ECOLI Ferrous-iron efflux pump FieF OS=Escherichia coli (strain K12) GN=fieF PE=1 SV=1 156 448 3.0E-07
sp|B1IVG4|FIEF_ECOLC Ferrous-iron efflux pump FieF OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|A8A719|FIEF_ECOHS Ferrous-iron efflux pump FieF OS=Escherichia coli O9:H4 (strain HS) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B1XB81|FIEF_ECODH Ferrous-iron efflux pump FieF OS=Escherichia coli (strain K12 / DH10B) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|C5A082|FIEF_ECOBW Ferrous-iron efflux pump FieF OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|B7M6W6|FIEF_ECO8A Ferrous-iron efflux pump FieF OS=Escherichia coli O8 (strain IAI1) GN=fieF PE=3 SV=1 156 448 3.0E-07
sp|Q0SZA5|FIEF_SHIF8 Cation-efflux pump FieF OS=Shigella flexneri serotype 5b (strain 8401) GN=fieF PE=3 SV=1 156 448 5.0E-07
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 123 367 5.0E-07
sp|A7MQ82|FIEF_CROS8 Cation-efflux pump FieF OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fieF PE=3 SV=1 161 448 2.0E-06
sp|B5FPR1|FIEF_SALDC Cation-efflux pump FieF OS=Salmonella dublin (strain CT_02021853) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|B5BJI1|FIEF_SALPK Cation-efflux pump FieF OS=Salmonella paratyphi A (strain AKU_12601) GN=fieF PE=3 SV=1 157 448 3.0E-06
sp|B5QWZ4|FIEF_SALEP Cation-efflux pump FieF OS=Salmonella enteritidis PT4 (strain P125109) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|B5RFB0|FIEF_SALG2 Cation-efflux pump FieF OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|B4TCJ9|FIEF_SALHS Cation-efflux pump FieF OS=Salmonella heidelberg (strain SL476) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|B4T048|FIEF_SALNS Cation-efflux pump FieF OS=Salmonella newport (strain SL254) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|A9MZE6|FIEF_SALPB Cation-efflux pump FieF OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|C0Q413|FIEF_SALPC Cation-efflux pump FieF OS=Salmonella paratyphi C (strain RKS4594) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|Q8ZKR4|FIEF_SALTY Cation-efflux pump FieF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fieF PE=3 SV=1 157 450 3.0E-06
sp|Q6CZ45|FIEF_PECAS Cation-efflux pump FieF OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fieF PE=3 SV=1 155 450 3.0E-06
sp|B5F0P5|FIEF_SALA4 Cation-efflux pump FieF OS=Salmonella agona (strain SL483) GN=fieF PE=3 SV=1 157 448 3.0E-06
sp|Q5PIR7|FIEF_SALPA Cation-efflux pump FieF OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fieF PE=3 SV=1 157 448 3.0E-06
sp|Q57HF4|FIEF_SALCH Cation-efflux pump FieF OS=Salmonella choleraesuis (strain SC-B67) GN=fieF PE=3 SV=1 161 450 3.0E-06
sp|A9MI51|FIEF_SALAR Cation-efflux pump FieF OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fieF PE=3 SV=1 161 448 4.0E-06
sp|A8AL14|FIEF_CITK8 Cation-efflux pump FieF OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fieF PE=3 SV=1 156 448 4.0E-06
sp|B4TPS5|FIEF_SALSV Cation-efflux pump FieF OS=Salmonella schwarzengrund (strain CVM19633) GN=fieF PE=3 SV=1 157 448 5.0E-06
sp|C6DHK1|FIEF_PECCP Cation-efflux pump FieF OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fieF PE=3 SV=1 155 448 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0006811 ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046770
MAPGILKSTGTTYVHTSTPWASSFARPHSSQLRFCGPIGPALAHLFHSGLSRRRLYRSFSLAYTSGQTALHSKRL
IMMQRRAASTERKGQKSNEDVDRNPDHHDHSHSLFAHSHSHNGEDGSGHSHDAAHIVAALKGNKRDRGSYITLVG
LVSNIILTAAKGTAGWFLHSASLLADAGHSLSDLLGDLVVLVCWNLSRRPPSERYPYGFAKFETLGTTTVSLLLI
GGALGIGVHSYHLLLATISETLPSVPPGMIHTVIENVTLIAPNLPVSADSHVHSVDVNAAWFAAVGVLVKEWLYW
ITKRVAEQENSPVLFANALHHRSDAYSSGVALLAILGTWYFPAIPLDPIGGLIVSVVILQQGASLFKGAWGDLTD
AGVSRRKSESLRRSLTPLVKTGVHDDARMLIGIKDLRARRSGSMLFVDLTAQVAPELSVVQAKQLEGKINKTMQE
ARKEIAESLWIFI*
Coding >AgabiH97|046770
ATGGCCCCCGGTATCTTGAAAAGCACTGGTACAACATATGTACATACATCCACTCCATGGGCCTCTTCCTTTGCT
CGCCCGCACAGCAGTCAGCTTCGCTTCTGCGGGCCCATCGGTCCCGCACTTGCGCATCTTTTCCATTCTGGTCTT
AGCCGTCGTCGACTCTATCGTTCCTTCTCCCTTGCTTACACGTCGGGGCAGACTGCGCTCCATTCCAAACGACTC
ATCATGATGCAACGTCGTGCTGCGAGCACAGAACGGAAGGGACAGAAGTCGAACGAAGACGTTGATCGTAATCCG
GATCACCACGACCATTCACACTCGCTATTCGCTCATTCGCATTCGCACAACGGAGAAGATGGAAGTGGTCATTCT
CATGACGCTGCACATATTGTAGCTGCCCTCAAAGGGAATAAACGTGATAGAGGAAGCTATATTACCCTCGTTGGA
CTTGTTTCGAATATTATTCTGACTGCCGCAAAGGGTACAGCTGGATGGTTTCTCCATTCTGCGTCGCTCCTTGCG
GATGCTGGTCATTCACTTAGCGATCTCCTTGGAGACCTCGTCGTTCTAGTCTGTTGGAACCTCTCGCGGAGACCC
CCCTCGGAACGATATCCTTATGGCTTTGCCAAGTTTGAGACCCTGGGAACGACGACAGTATCACTGCTTTTAATT
GGTGGTGCCCTTGGCATCGGAGTTCATTCGTATCATTTGCTTTTAGCAACCATAAGCGAGACTCTGCCTTCTGTT
CCTCCTGGGATGATACACACCGTTATCGAAAACGTAACACTGATTGCACCAAATTTGCCTGTCAGTGCAGACTCA
CATGTACACTCTGTTGATGTCAATGCAGCATGGTTCGCTGCTGTGGGTGTTCTTGTAAAAGAATGGCTATATTGG
ATCACGAAGCGTGTGGCAGAGCAGGAAAATAGTCCAGTTTTATTTGCAAACGCTCTTCATCACCGCAGCGATGCG
TATTCCAGTGGAGTGGCGCTTCTAGCGATTTTAGGGACTTGGTACTTCCCAGCTATCCCTTTGGATCCTATAGGC
GGCCTTATAGTGTCTGTTGTCATATTACAACAAGGAGCCAGCTTATTCAAGGGCGCATGGGGTGATCTAACCGAC
GCTGGAGTCTCTCGAAGAAAATCAGAATCACTCAGGCGGTCTCTGACGCCCCTTGTAAAAACTGGCGTACATGAT
GATGCTCGAATGTTGATCGGCATTAAAGACCTGCGAGCGCGAAGATCCGGCTCCATGCTATTTGTTGACCTGACG
GCTCAGGTCGCCCCAGAGCTGTCTGTCGTTCAGGCAAAACAGTTAGAGGGCAAAATCAACAAGACGATGCAGGAG
GCAAGGAAAGAAATAGCTGAGAGTCTGTGGATTTTCATCTAG
Transcript >AgabiH97|046770
ATGGCCCCCGGTATCTTGAAAAGCACTGGTACAACATATGTACATACATCCACTCCATGGGCCTCTTCCTTTGCT
CGCCCGCACAGCAGTCAGCTTCGCTTCTGCGGGCCCATCGGTCCCGCACTTGCGCATCTTTTCCATTCTGGTCTT
AGCCGTCGTCGACTCTATCGTTCCTTCTCCCTTGCTTACACGTCGGGGCAGACTGCGCTCCATTCCAAACGACTC
ATCATGATGCAACGTCGTGCTGCGAGCACAGAACGGAAGGGACAGAAGTCGAACGAAGACGTTGATCGTAATCCG
GATCACCACGACCATTCACACTCGCTATTCGCTCATTCGCATTCGCACAACGGAGAAGATGGAAGTGGTCATTCT
CATGACGCTGCACATATTGTAGCTGCCCTCAAAGGGAATAAACGTGATAGAGGAAGCTATATTACCCTCGTTGGA
CTTGTTTCGAATATTATTCTGACTGCCGCAAAGGGTACAGCTGGATGGTTTCTCCATTCTGCGTCGCTCCTTGCG
GATGCTGGTCATTCACTTAGCGATCTCCTTGGAGACCTCGTCGTTCTAGTCTGTTGGAACCTCTCGCGGAGACCC
CCCTCGGAACGATATCCTTATGGCTTTGCCAAGTTTGAGACCCTGGGAACGACGACAGTATCACTGCTTTTAATT
GGTGGTGCCCTTGGCATCGGAGTTCATTCGTATCATTTGCTTTTAGCAACCATAAGCGAGACTCTGCCTTCTGTT
CCTCCTGGGATGATACACACCGTTATCGAAAACGTAACACTGATTGCACCAAATTTGCCTGTCAGTGCAGACTCA
CATGTACACTCTGTTGATGTCAATGCAGCATGGTTCGCTGCTGTGGGTGTTCTTGTAAAAGAATGGCTATATTGG
ATCACGAAGCGTGTGGCAGAGCAGGAAAATAGTCCAGTTTTATTTGCAAACGCTCTTCATCACCGCAGCGATGCG
TATTCCAGTGGAGTGGCGCTTCTAGCGATTTTAGGGACTTGGTACTTCCCAGCTATCCCTTTGGATCCTATAGGC
GGCCTTATAGTGTCTGTTGTCATATTACAACAAGGAGCCAGCTTATTCAAGGGCGCATGGGGTGATCTAACCGAC
GCTGGAGTCTCTCGAAGAAAATCAGAATCACTCAGGCGGTCTCTGACGCCCCTTGTAAAAACTGGCGTACATGAT
GATGCTCGAATGTTGATCGGCATTAAAGACCTGCGAGCGCGAAGATCCGGCTCCATGCTATTTGTTGACCTGACG
GCTCAGGTCGCCCCAGAGCTGTCTGTCGTTCAGGCAAAACAGTTAGAGGGCAAAATCAACAAGACGATGCAGGAG
GCAAGGAAAGAAATAGCTGAGAGTCTGTGGATTTTCATCTAG
Gene >AgabiH97|046770
ATGGCCCCCGGTATCTTGAAAAGCACTGGTACAACATATGTACATACATCCACTCCATGGGCCTCTTCCTTTGCT
CGCCCGCACAGCAGTCAGCTTCGCTTCTGCGGGCCCATCGGTCCCGCACTTGCGTATGTTTGGCTGTCAGTCCCT
GAGAACTGTAAACGTGCCATCTTGTAACCATCACAGGCATCTTTTCCATTCTGGTCTTAGCCGTCGTCGACTCTA
TCGTTCCTTCTCCCTTGCTTACACGTCGGGGCAGACTGCGCTCCATTCCAAACGACTCATCATGATGCAACGTCG
TGCTGCGAGCACAGAACGGAAGGGACAGAAGTCGAACGAAGACGTTGATCGTAATCCGGATCACCACGACCATTC
ACACTCGCTATTCGCTCATTCGCATTCGCACAACGGAGAAGATGGAAGTGGTCATTCTCATGACGCTGCACATAT
TGTAGCTGCCCTCAAAGGGAATAAACGTGAGCTCCTATTTCCTCCCCTTCCTATTAGCGCGCTCACTATTGCCCG
CTTATCCCGTTGCTTAGGTGATAGAGGAAGCTATATTACCCTCGTTGGACTTGTTTCGAATATTATTCTGACTGC
CGCAAAGGGTACAGCTGGATGGTTTCTCCATTCTGCGTCGCTCCTTGCGGATGCTGGTCATTCACTTAGCGGTAC
GTATTTGTTTCCCTCTTGGGGTGAAGGTTCTGATTCAATGGCTTCCTTATAGATCTCCTTGGAGACCTCGTCGTT
CTAGTCTGTTGGAACCTCTCGCGGAGACCCCCCTCGGAACGATATCCTTATGGCTTTGCCAAGTTTGAGACCCTG
GGAACGACGACAGTATCACTGCTTTTAATTGGTGGTGCCCTTGGCATCGGAGTTCATTCGTATCATTTGCTTTTA
GCAACCATAAGCGAGACTCTGCCTTCTGTTCCTCCTGGGATGATACACACCGTTATCGAAAACGTAACACTGATT
GCACCAAATTTGCCTGTCAGTGCAGACTCACATGTACACTCTGTTGATGTCAATGCAGCATGGTTCGCTGCTGTG
GGTGTTCTTGTAAAAGAATGGCTATATTGGATCACGAAGCGTGTGGCAGAGCAGGAAAATAGTCCAGTTTTATTT
GCAAACGCTCTTCATCACCGCAGCGATGCGTATTCCAGTGGAGTGGCGCTTCTAGCGATTTTAGGGACTTGGTAC
TTCCCAGCTATCCCTTTGGATCCTATAGGCGGTGAATAGTCTTCCATTCAACTTGAAAATGATTAGCTAACAAAA
TCATCAAACCTACGTCAGGCCTTATAGTGTCTGTTGTCATATTACAACAAGGAGCCAGCTTATTCAAGGGCGCAT
GGGGTGATCTAACCGACGCTGGAGTCTCTCGAAGAAAATCAGAATCACTCAGGCGGTCTCTGACGCCCCTTGTAA
AAACTGGCGTACATGATGATGCTCGAATGTTGATCGGCATTAAAGACCTGCGAGCGCGAAGATCCGGCTCCATGC
TATTTGTTGACCTGACGGCTCAGGTCGCCCCAGAGCTGTCTGTCGTTCAGGCAAAACAGTTAGAGGGCAAAATCA
ACAAGACGATGCAGGAGGCAAGGAAAGAAATAGCTGAGGTCAGGGTTAAGTTCGAGCCAGTTCCGTCTGAATGAC
GCGTATTACCGATACTCGTCAACTTAACTCTAGAGTCTGTGGATTTTGTACGTCGTATTATACTTTGTTTGTAAA
CTGCTCTGACAGCGACACCTTGGACTGACCTCATGTGTTGATAAGCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail