Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046610
Gene name
Locationscaffold_2:1991548..1991985
Strand-
Gene length (bp)437
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07896 DUF1674 Protein of unknown function (DUF1674) 4.1E-06 34 62

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C6Y4C4|SDHF4_SCHPO Succinate dehydrogenase assembly factor 4, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.16 PE=2 SV=1 14 62 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046610
MITARLPPFLVSQLSRHGRTMANLNRPSPPSLPREQQQLLKPEFEGNINPKTGEKGGPKREPPSCILTRSECNWL
IS*
Coding >AgabiH97|046610
ATGATTACAGCCCGACTCCCACCTTTTCTTGTATCGCAACTCTCACGCCATGGCCGTACAATGGCAAATTTGAAC
AGACCCTCTCCTCCGTCTCTTCCCAGGGAGCAGCAGCAGCTTCTCAAGCCAGAATTTGAAGGGAACATCAACCCT
AAAACGGGAGAGAAAGGCGGGCCCAAGCGTGAACCGCCTAGCTGTATTCTTACGCGATCTGAATGTAACTGGCTA
ATCTCATAA
Transcript >AgabiH97|046610
ATGATTACAGCCCGACTCCCACCTTTTCTTGTATCGCAACTCTCACGCCATGGCCGTACAATGGCAAATTTGAAC
AGACCCTCTCCTCCGTCTCTTCCCAGGGAGCAGCAGCAGCTTCTCAAGCCAGAATTTGAAGGGAACATCAACCCT
AAAACGGGAGAGAAAGGCGGGCCCAAGCGTGAACCGCCTAGCTGTATTCTTACGCGATCTGAATGTAACTGGCTA
ATCTCATAA
Gene >AgabiH97|046610
ATGATTACAGCCCGACTCCCACCTTTTCTTGTATCGCAACTCTCACGCCATGGCCGTACAATGGCAAATTTGAAC
AGACCCTCTCCTCCGTCTCTTCCCAGGGAGCAGCAGCGTGAGTTTGAGGAGCTCATTCGCAAAGCCCAGGCCCCT
TCCTCGGGCGAGACTACACAATTACACCCTGACGCTCCAGAGCTTCTCAAGCCAGAATTTGAAGGGAACATCAAC
CCTAAAACGGGAGAGAAAGGCGGGCCCAAGCGTGAACCGGTCGGACGTTGGAGTGTAGAAGGAGGCGACTGGAGT
TTCAAAGGCCGTGTCACGGATTTCTAGCCTAGCTGTATTCTTACGGTATGTTATGCCATTCCTGACATTGCAACC
CTTCATTAACATTGATCCTGGTGCTGTCGCAGCGATCTGAATGTAACTGGCTAATCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail