Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046550
Gene name
Locationscaffold_2:1979391..1980309
Strand-
Gene length (bp)918
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like 1.4E-55 43 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM10|ALG14_CRYNJ UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG14 PE=3 SV=1 11 225 2.0E-47
sp|P0CM11|ALG14_CRYNB UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG14 PE=3 SV=1 11 225 2.0E-47
sp|O14199|ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg14 PE=3 SV=1 10 231 3.0E-41
sp|Q6AY85|ALG14_RAT UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus GN=Alg14 PE=2 SV=1 7 231 2.0E-35
sp|Q6BMD0|ALG14_DEBHA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG14 PE=3 SV=2 41 234 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CM10|ALG14_CRYNJ UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG14 PE=3 SV=1 11 225 2.0E-47
sp|P0CM11|ALG14_CRYNB UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG14 PE=3 SV=1 11 225 2.0E-47
sp|O14199|ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg14 PE=3 SV=1 10 231 3.0E-41
sp|Q6AY85|ALG14_RAT UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus GN=Alg14 PE=2 SV=1 7 231 2.0E-35
sp|Q6BMD0|ALG14_DEBHA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG14 PE=3 SV=2 41 234 1.0E-33
sp|Q96F25|ALG14_HUMAN UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens GN=ALG14 PE=1 SV=1 41 234 3.0E-33
sp|Q9D081|ALG14_MOUSE UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Mus musculus GN=Alg14 PE=1 SV=1 42 234 8.0E-33
sp|Q6CF02|ALG14_YARLI UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG14 PE=3 SV=1 42 234 8.0E-33
sp|Q5A5N6|ALG14_CANAL UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG14 PE=3 SV=1 31 234 1.0E-30
sp|Q4WNB5|ALG14_ASPFU UDP-N-acetylglucosamine transferase subunit alg14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg14 PE=3 SV=1 62 234 1.0E-25
sp|Q750Y9|ALG14_ASHGO UDP-N-acetylglucosamine transferase subunit ALG14 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG14 PE=3 SV=1 44 234 6.0E-17
sp|P38242|ALG14_YEAST UDP-N-acetylglucosamine transferase subunit ALG14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG14 PE=1 SV=1 33 234 6.0E-16
sp|Q6FV75|ALG14_CANGA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG14 PE=3 SV=1 42 234 4.0E-15
sp|Q6CJG3|ALG14_KLULA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG14 PE=3 SV=1 42 234 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006488 dolichol-linked oligosaccharide biosynthetic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006490 oligosaccharide-lipid intermediate biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 4 23 19
2 121 143 22
3 158 180 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046550
MNFSQAIACILALALCLYRLYVAFTSKPGSHSRKSSAATCSLAVFLGSGGHTSEALQLLSSLDFTRYTPRRYIIS
SGDHLSAQKAAMLEQAKASSLGPQKRGSKEDYMILTIPRARRVHQSIFSTPPSALWSLLVCIYYLTVEPLLMFQT
QTKIMTDVLVLNGPGTCITLSIAVLINKFLGLPSPHIIYVESFARVRTLSVSGRLLQHFADRFIVQWPQLTQGDN
RREYIGWLI*
Coding >AgabiH97|046550
ATGAATTTCTCACAAGCGATTGCCTGTATCCTTGCGCTGGCGTTGTGTCTCTATCGACTCTATGTTGCCTTCACC
TCTAAGCCAGGTTCACACTCTAGAAAGTCGTCGGCAGCCACATGTAGCCTCGCTGTCTTCCTTGGTTCAGGAGGA
CATACCAGCGAAGCGCTACAACTTCTGTCATCTCTCGATTTTACACGGTACACCCCGAGAAGATACATCATCAGC
AGTGGCGATCATTTGAGCGCGCAGAAGGCAGCTATGCTAGAACAAGCTAAAGCTTCATCCCTTGGGCCTCAGAAA
CGAGGGTCAAAGGAGGACTATATGATTCTCACAATACCAAGAGCCCGTCGAGTGCATCAATCGATCTTCTCAACG
CCGCCTTCTGCACTTTGGTCTCTTCTAGTTTGCATTTATTACCTCACCGTCGAACCTCTTCTTATGTTTCAGACT
CAAACTAAGATCATGACAGACGTCCTTGTTTTAAATGGGCCCGGCACCTGTATTACGCTGTCTATCGCAGTTCTT
ATCAACAAGTTCTTGGGGCTGCCTTCTCCTCATATAATATATGTAGAGTCTTTCGCACGGGTACGCACGTTGTCC
GTATCTGGTCGCCTACTTCAACATTTCGCAGACAGATTCATTGTGCAATGGCCTCAACTAACACAAGGTGATAAC
CGTAGGGAGTATATAGGTTGGTTGATATGA
Transcript >AgabiH97|046550
ATGAATTTCTCACAAGCGATTGCCTGTATCCTTGCGCTGGCGTTGTGTCTCTATCGACTCTATGTTGCCTTCACC
TCTAAGCCAGGTTCACACTCTAGAAAGTCGTCGGCAGCCACATGTAGCCTCGCTGTCTTCCTTGGTTCAGGAGGA
CATACCAGCGAAGCGCTACAACTTCTGTCATCTCTCGATTTTACACGGTACACCCCGAGAAGATACATCATCAGC
AGTGGCGATCATTTGAGCGCGCAGAAGGCAGCTATGCTAGAACAAGCTAAAGCTTCATCCCTTGGGCCTCAGAAA
CGAGGGTCAAAGGAGGACTATATGATTCTCACAATACCAAGAGCCCGTCGAGTGCATCAATCGATCTTCTCAACG
CCGCCTTCTGCACTTTGGTCTCTTCTAGTTTGCATTTATTACCTCACCGTCGAACCTCTTCTTATGTTTCAGACT
CAAACTAAGATCATGACAGACGTCCTTGTTTTAAATGGGCCCGGCACCTGTATTACGCTGTCTATCGCAGTTCTT
ATCAACAAGTTCTTGGGGCTGCCTTCTCCTCATATAATATATGTAGAGTCTTTCGCACGGGTACGCACGTTGTCC
GTATCTGGTCGCCTACTTCAACATTTCGCAGACAGATTCATTGTGCAATGGCCTCAACTAACACAAGGTGATAAC
CGTAGGGAGTATATAGGTTGGTTGATATGA
Gene >AgabiH97|046550
ATGAATTTCTCACAAGCGATTGCCTGTATCCTTGCGCTGGCGTTGTGTCTCTATCGACTCTATGTTGCCTTCACC
TCTAAGCCAGGTTCACACTCTAGAAAGTCGTCGGCAGCCACATGTAGCCTCGCTGTCTTCCTTGGTTCAGGTCAC
TCTTTTCACTCTGGACTCATGGCTTACGCTGGGCTTATATGATGAGCAGGAGGACATACCAGCGAAGCGCTACAA
CTTCTGTCATCTCTCGATTTTACACGGTACACCCCGAGAAGATACATCATCAGCAGTGGCGATCATTTGAGCGCG
CAGAAGGCAGCTATGCTAGAACAAGCTAAAGCTTCATCCCTTGGGGTTCGTAATATATCTTTAATTCCTTCCTAT
TATTCATGTCATCGCACAGCCTCAGAAACGAGGGTCAAAGGAGGACTATATGATTCTCACAATACCAAGAGCCCG
TCGAGTGCATCAATCGATCTTCTCAACGCCGCCTTCTGCACTTTGGTCTCTTCTAGTTTGCATTTATTACCTCAC
CGTCGAACCTCTTCTTATGTTTCAGACTCAAACTAAGATCATGACAGACGTCCTTGTTTTAAATGGGCCCGGCAC
CTGTATTACGCTGTCTATCGCAGTTCTTATCAACAAGGTAAATCTTAGTCTCCAATCGTTCGTGTACTATTTGAC
CTTTTGGGTTCAGTTCTTGGGGCTGCCTTCTCCTCATATAATATATGTAGAGTCTTTCGCACGGGTACGCACGTT
GTCCGTATCTGGTCGCCTACTTCAACATTTCGCAGACAGGTGAGTCACTTGCAAAGCTGGAAGCAATGTTTAACT
TCATCCTGGGTGCCAAAATTTAGATTCATTGTGCAATGGCCTCAACTAACACAAGGTGATAACCGTAGGGAGTAT
ATAGGTTGGTTGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail