Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046460
Gene name
Locationscaffold_2:1964643..1965816
Strand+
Gene length (bp)1173
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03443 AA9 Auxiliary Activity family 9 (formerly GH61) 9.0E-55 30 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 1 246 8.0E-74
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 70 248 4.0E-39
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 4 248 2.0E-37
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 11 248 2.0E-35
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 60 246 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00023|CEL1_AGABI Cellulose-growth-specific protein OS=Agaricus bisporus GN=cel1 PE=3 SV=1 1 246 8.0E-74
sp|Q7Z9M7|GUN7_HYPJQ Endoglucanase-7 OS=Hypocrea jecorina (strain QM6a) GN=cel61b PE=1 SV=3 70 248 4.0E-39
sp|O14405|GUN4_HYPJE Endoglucanase-4 OS=Hypocrea jecorina GN=cel61a PE=1 SV=1 4 248 2.0E-37
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 11 248 2.0E-35
sp|A1DBS6|EGLD_NEOFI Probable endo-beta-1,4-glucanase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglD PE=3 SV=1 60 246 5.0E-28
sp|Q4WBU0|EGLD_ASPFU Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglD PE=3 SV=1 60 246 1.0E-27
sp|B0Y9G4|EGLD_ASPFC Probable endo-beta-1,4-glucanase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglD PE=3 SV=1 60 246 1.0E-27
sp|Q0CEU4|EGLD_ASPTN Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglD PE=3 SV=1 60 246 9.0E-26
sp|Q2US83|EGLD_ASPOR Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglD PE=3 SV=1 60 248 3.0E-24
sp|B8MXJ7|EGLD_ASPFN Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglD PE=3 SV=1 60 248 3.0E-24
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 7 246 5.0E-24
sp|A1C4H2|EGLD_ASPCL Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglD PE=3 SV=1 60 246 9.0E-24
sp|A2R5N0|EGLD_ASPNC Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglD PE=3 SV=1 60 246 8.0E-23
sp|Q96WQ9|EGLD_ASPKW Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) GN=eglD PE=3 SV=1 61 246 2.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 33.95 14.25 53.65
Initials Initials knots 40.72 21.67 59.76
Pileal_Stipeal_center Stage I stipe center 72.75 41.63 103.87
Pileal_Stipeal_shell Stage I stipe shell 140.51 79.44 201.58
DIF_stipe_center Stage II stipe center 103.58 61.26 145.89
DIF_stipe_shell Stage II stipe shell 199.67 119.86 279.48
DIF_stipe_skin Stage II stipe skin 141.10 84.41 197.79
DIF_cap_skin Stage II cap skin 211.80 125.99 297.60
DIF_cap_tissue Stage II cap tissue 464.04 267.10 660.99
DIF_gill_tissue Stage II gill tissue 404.67 233.38 575.96
YFB_stipe_center Young fruiting body stipe center 83.56 42.16 124.96
YFB_stipe_shell Young fruiting body stipe shell 173.04 100.03 246.05
YFB_stipe_skin Young fruiting body stipe skin 208.44 117.34 299.53
YFB_cap_skin Young fruiting body cap skin 150.77 89.09 212.46
YFB_cap_tissue Young fruiting body cap tissue 721.21 396.24 1046.19
YFB_gill_tissue Young fruiting body gill tissue 64.02 35.67 92.37
YFB_veil Young fruiting body veil 81.49 45.81 117.18

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.009123 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.071968 no
Casing YFB_veil 0.007782 yes
Casing Initials 0.739359 no
Casing Pileal_Stipeal_center 0.026710 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.001625 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.001140 yes
DIF_gill_tissue YFB_stipe_skin 0.013186 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.047373 yes
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.000613 yes
YFB_stipe_center YFB_stipe_shell 0.018624 yes
YFB_stipe_center YFB_stipe_skin 0.002951 yes
YFB_stipe_center YFB_cap_skin 0.061473 no
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.524822 no
YFB_stipe_center YFB_veil 0.967364 no
YFB_stipe_shell YFB_stipe_skin 0.647664 no
YFB_stipe_shell YFB_cap_skin 0.753475 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.005671 yes
YFB_stipe_skin YFB_cap_skin 0.317691 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.001140 yes
YFB_cap_skin YFB_veil 0.024946 yes
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.540581 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.023933 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.172056 no
Initials YFB_veil 0.021322 yes
Initials Pileal_Stipeal_center 0.058347 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.783955 no
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_skin 0.005302 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.791928 no
Pileal_Stipeal_center YFB_veil 0.818295 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.015819 yes
Pileal_Stipeal_center DIF_stipe_center 0.253577 no
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.012880 yes
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_center 0.111482 no
Pileal_Stipeal_shell YFB_stipe_shell 0.606318 no
Pileal_Stipeal_shell YFB_stipe_skin 0.215620 no
Pileal_Stipeal_shell YFB_cap_skin 0.893375 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.004160 yes
Pileal_Stipeal_shell YFB_veil 0.061662 no
Pileal_Stipeal_shell DIF_stipe_center 0.358752 no
Pileal_Stipeal_shell DIF_stipe_shell 0.262471 no
Pileal_Stipeal_shell DIF_stipe_skin 0.992883 no
Pileal_Stipeal_shell DIF_cap_skin 0.177318 no
Pileal_Stipeal_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.611401 no
DIF_stipe_center YFB_stipe_shell 0.069197 no
DIF_stipe_center YFB_stipe_skin 0.007092 yes
DIF_stipe_center YFB_cap_skin 0.209726 no
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.104271 no
DIF_stipe_center YFB_veil 0.515009 no
DIF_stipe_center DIF_stipe_shell 0.009446 yes
DIF_stipe_center DIF_stipe_skin 0.324322 no
DIF_stipe_center DIF_cap_skin 0.005671 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.004928 yes
DIF_stipe_shell YFB_stipe_center 0.003765 yes
DIF_stipe_shell YFB_stipe_shell 0.742678 no
DIF_stipe_shell YFB_stipe_skin 0.937312 no
DIF_stipe_shell YFB_cap_skin 0.385534 no
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.245434 no
DIF_stipe_shell DIF_cap_skin 0.909230 no
DIF_stipe_shell DIF_cap_tissue 0.001140 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.095644 no
DIF_stipe_skin YFB_stipe_shell 0.591662 no
DIF_stipe_skin YFB_stipe_skin 0.193384 no
DIF_stipe_skin YFB_cap_skin 0.893112 no
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.002951 yes
DIF_stipe_skin YFB_veil 0.046117 yes
DIF_stipe_skin DIF_cap_skin 0.152056 no
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.013782 yes
DIF_cap_skin YFB_stipe_center 0.003365 yes
DIF_cap_skin YFB_stipe_shell 0.601269 no
DIF_cap_skin YFB_stipe_skin 0.977579 no
DIF_cap_skin YFB_cap_skin 0.267771 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.000613 yes
DIF_cap_skin YFB_veil 0.000613 yes
DIF_cap_skin DIF_cap_tissue 0.001140 yes
DIF_cap_tissue DIF_gill_tissue 0.762306 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.003365 yes
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.164366 no
DIF_cap_tissue YFB_gill_tissue 0.000613 yes
DIF_cap_tissue YFB_veil 0.000613 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046460
MRYLTTFTAFLTIALRQASLVASHGGVIGYDIASKYYNGFSAYNTPIGQSTIQREWDTFNPITNPTDSFLSCNNN
GASLGSGQLSATVDAGSQVIAYWNQWPHTIGPVMVYMASCSGACASATPSDLSWFKIDEAGLMSGTLTTGQWAMG
ELVANNNSWTTTIPANLAPGEYMIRHELLAIHTSNQPQFYPECAHLVVTGSGSAQPSGNSLVRFPGAYKVSDPGV
TIDIYSHPDVTDYTIPGPAVWRG*
Coding >AgabiH97|046460
ATGAGGTACCTGACAACATTTACTGCTTTTCTTACTATCGCCTTGCGCCAGGCCAGCTTGGTAGCCTCTCATGGC
GGTGTCATAGGCTACGACATTGCCAGCAAATATTATAATGGCTTTTCCGCTTACAACACGCCTATTGGCCAATCT
ACTATCCAGCGCGAATGGGATACCTTTAACCCTATTACAAACCCCACGGACAGTTTTCTTTCTTGCAATAATAAT
GGCGCATCCCTCGGGTCTGGACAACTTTCTGCAACGGTTGATGCTGGAAGTCAAGTCATTGCATACTGGAACCAA
TGGCCCCACACCATTGGGCCCGTCATGGTCTATATGGCCAGTTGCTCCGGTGCCTGTGCTTCAGCCACGCCTTCG
GATCTCTCTTGGTTCAAAATCGATGAGGCTGGTTTGATGTCGGGAACATTGACCACGGGCCAGTGGGCAATGGGT
GAGCTTGTGGCTAACAACAACTCTTGGACCACTACCATCCCTGCAAATCTTGCTCCCGGAGAGTACATGATCAGG
CATGAGCTCTTGGCCATTCATACATCCAACCAACCCCAGTTCTATCCGGAATGTGCTCACCTAGTCGTCACTGGT
AGCGGTAGCGCTCAACCTTCCGGAAATTCTCTCGTCAGATTCCCTGGTGCATATAAAGTATCTGACCCCGGGGTC
ACCATTGATATCTACTCCCACCCCGATGTTACCGACTACACCATTCCGGGACCCGCTGTATGGAGGGGTTGA
Transcript >AgabiH97|046460
ATGAGGTACCTGACAACATTTACTGCTTTTCTTACTATCGCCTTGCGCCAGGCCAGCTTGGTAGCCTCTCATGGC
GGTGTCATAGGCTACGACATTGCCAGCAAATATTATAATGGCTTTTCCGCTTACAACACGCCTATTGGCCAATCT
ACTATCCAGCGCGAATGGGATACCTTTAACCCTATTACAAACCCCACGGACAGTTTTCTTTCTTGCAATAATAAT
GGCGCATCCCTCGGGTCTGGACAACTTTCTGCAACGGTTGATGCTGGAAGTCAAGTCATTGCATACTGGAACCAA
TGGCCCCACACCATTGGGCCCGTCATGGTCTATATGGCCAGTTGCTCCGGTGCCTGTGCTTCAGCCACGCCTTCG
GATCTCTCTTGGTTCAAAATCGATGAGGCTGGTTTGATGTCGGGAACATTGACCACGGGCCAGTGGGCAATGGGT
GAGCTTGTGGCTAACAACAACTCTTGGACCACTACCATCCCTGCAAATCTTGCTCCCGGAGAGTACATGATCAGG
CATGAGCTCTTGGCCATTCATACATCCAACCAACCCCAGTTCTATCCGGAATGTGCTCACCTAGTCGTCACTGGT
AGCGGTAGCGCTCAACCTTCCGGAAATTCTCTCGTCAGATTCCCTGGTGCATATAAAGTATCTGACCCCGGGGTC
ACCATTGATATCTACTCCCACCCCGATGTTACCGACTACACCATTCCGGGACCCGCTGTATGGAGGGGTTGA
Gene >AgabiH97|046460
ATGAGGTACCTGACAACATTTACTGCTTTTCTTACTATCGCCTTGCGCCAGGCCAGCTTGGTATCAATTTTGGTT
TTTGTGGTTATTCTCCCCCTTATCGTTCTTCGACTCTGTAGGTAGCCTCTCATGGCGGTGTCATAGGCTACGACA
TTGCCAGCAAATATTATAATGGGTATGATCACCTTATGCTCAATAACACCACTCACGATACAATAAAGCTTTTCC
GCTTACAACACGCCTATTGGCCAATCTACTATCCAGGTATGCTATCATTCCTCCGGGTTTATCAAGGATCATATT
TAATACGGCGTAGCGCGAATGGGATACCTTTAACCCTATTACAAACCCCACGGACAGTTTTCTTTCTTGCAATAA
TAATGGCGCATCCCTCGGGTCTGGACAACTTTCTGCAACGGTTGATGCTGGAAGTCAAGTCATTGCATACTGGAA
CCAATGGCCCCACACCATTGGGGTGCGCATATCCTTCAACCATGGGTTATTCCGTGTTCACTCTCTGTCAGCCCG
TCATGGTCTATATGGCCAGTTGCTCCGGTGCCTGTGCTTCAGCCACGCCTTCGGATCTCTCTTGGGTGAGTGATG
AATACAGTTGAGAATAGTATGCTAGTTGGTCAACTTCCATACCCAGTTCAAAATCGATGAGGCTGGTTTGATGTC
GGGAACATTGACCACGGGCCAGTGGGCAATGGGTGAGCTTGTGGCTAACAACAACTCTTGGTATTTCTGGTCAAT
TCAATTTATCTAAAAGCAATAATCAGCGGTATAGGACCACTACCATCCCTGCAAATCTTGCTCCCGGAGAGTACA
TGATCAGGCATGAGGTCAGATCGAAAGGATTGCTTATAGAACACCAAGGCTTAAAGTTCTCCTTTTTCCCATCAG
CTCTTGGCCATTCATACATCCAACCAACCCCAGTTCTATCCGGAATGTGCTCACCTAGTCGTCACTGGTAGCGGT
AGCGCTCAACCTTCCGGAAATTCTCTCGTCAGATTCCCTGGTGCATATAAAGTGTAAGTCCCATCCATATTTAGC
TGTAGACAAGTGTATAGATAACATACTATGCTCAGATCTGACCCCGGGGTCACCATTGATATCTACTCCCACCCC
GATGTTACCGACTACACCATTCCGGGACCCGCTGTATGGAGGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail