Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046330
Gene name
Locationscaffold_2:1932716..1935498
Strand+
Gene length (bp)2782
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 2.7E-201 60 583

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 628 6.0E-169
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 1 628 1.0E-167
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 5 628 8.0E-167
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 1 628 2.0E-166
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 3 628 1.0E-165
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 19 628 6.0E-169
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 1 628 1.0E-167
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 5 628 8.0E-167
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 1 628 2.0E-166
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 3 628 1.0E-165
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 7 628 7.0E-165
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 7 628 8.0E-165
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 7 628 6.0E-164
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 7 628 1.0E-163
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 16 628 2.0E-163
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 8 628 1.0E-162
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 8 628 2.0E-162
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 2 628 1.0E-159
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 17 628 6.0E-155
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 18 628 6.0E-155
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 18 628 2.0E-154
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 17 628 2.0E-154
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 13 628 1.0E-131
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 19 628 2.0E-129
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 8 628 5.0E-120
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 1 628 3.0E-92
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 1 628 4.0E-90
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 29 628 3.0E-89
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 29 628 4.0E-85
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 13 628 5.0E-85
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 234 628 1.0E-80
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 234 628 2.0E-80
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 28 628 6.0E-73
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 28 628 7.0E-73
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 28 628 4.0E-72
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 28 628 2.0E-71
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 16 628 4.0E-71
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 28 628 6.0E-65
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 16 628 5.0E-57
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 26 622 1.0E-43
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 266 288 22
2 332 354 22
3 364 386 22
4 399 421 22
5 436 458 22
6 485 507 22
7 522 544 22
8 557 576 19
9 596 618 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046330
MRARAFTVLFISLLPVTSAFYLPGAAPTNYREGEQVPVFVNALTPMLSGSDDPKLKSLINYDYYNPKLRFCEPDD
GAQSQPESLGSILFGDRLFNSPYDIKMVSENTTCKMLCLQPNVTGEEAKFINDRIREDYALNWLVDGLPAAEMKV
DVRNEDVFYDMGFNLGNNDGQFQNLPVLNNHYDIVLRYHRPTPDTYRVVGVLVWPSSVGGPQTNEAICDSDNELS
LNEDQTQAVRYTYRVTWNESDTPWATRWDNYLHIYDPRIHWFSLINSIIIVFFLCGMVGMILLRSVSRDISRYNA
IDVSEDVQEDWGWKLVHGEVFRTPQNPMFLSIMVGNGVQLVAMVGITLVFALLGFLSPSNRGSLATVMMVCWSFF
GCIGGYFSSRVYASLGGQNKRKNAFFTATIFPTAIFIIIFILNFFLIVAGSSGAVPFGTMLLIILLWFGISAPLS
AIGAYFGSKHGAVKHPVRVNPIPRQIPPGPKYLRPWVTAILGGILPFGAAFIELYFVLSSLFASRAYYAFGFLAL
TASIVALTTATVTILFTYFSLCAEDYRWHWRAFLTGGGSAFWLFAYGLFYWGSRMSLDSLSSLLLYLGYLFLLAL
MDFLVTGTIGFLASYWVVRRLYTAIRVD*
Coding >AgabiH97|046330
ATGCGTGCTCGGGCTTTTACAGTCCTTTTTATCTCGCTTCTGCCCGTCACTTCAGCCTTCTACCTGCCTGGTGCA
GCGCCGACCAATTACCGCGAGGGTGAACAAGTCCCAGTTTTCGTGAATGCCCTAACTCCCATGCTGAGCGGGAGT
GACGATCCCAAACTCAAATCACTCATTAACTACGACTACTACAATCCTAAACTTCGTTTCTGCGAGCCTGATGAT
GGTGCCCAGTCCCAACCTGAATCATTGGGCTCCATTCTTTTCGGGGACCGTCTATTCAACTCACCATATGACATC
AAGATGGTTTCAGAAAATACAACCTGCAAAATGCTTTGTCTCCAACCCAATGTTACAGGAGAAGAAGCCAAATTT
ATCAATGACAGGATTCGAGAGGACTACGCCCTCAATTGGCTCGTGGATGGACTCCCTGCTGCAGAAATGAAAGTA
GACGTCCGAAATGAAGACGTTTTCTACGATATGGGTTTCAATCTAGGAAATAATGACGGCCAATTTCAGAATCTC
CCTGTTCTCAACAACCATTATGATATAGTGCTAAGATATCATCGGCCGACACCGGATACCTATCGCGTAGTTGGG
GTCCTTGTATGGCCTTCAAGTGTTGGTGGTCCGCAGACCAATGAAGCGATATGCGACTCCGACAACGAGCTCTCC
CTTAATGAGGACCAGACCCAGGCAGTTCGGTATACATATAGAGTCACTTGGAATGAGTCCGACACTCCCTGGGCA
ACACGCTGGGATAATTATCTCCATATTTATGATCCTCGAATCCATTGGTTCAGTCTCATCAACTCCATCATCATC
GTGTTTTTCCTTTGCGGTATGGTTGGCATGATTCTACTTCGTAGCGTCTCTCGTGATATATCCCGATACAATGCC
ATTGACGTCAGCGAAGATGTGCAAGAAGACTGGGGGTGGAAGCTAGTCCATGGTGAGGTTTTCAGGACACCTCAA
AACCCCATGTTTTTGTCCATCATGGTCGGTAACGGAGTGCAACTCGTCGCGATGGTTGGGATAACCTTAGTTTTT
GCTCTCTTGGGATTCTTGTCACCTTCCAATCGCGGTTCTCTTGCGACCGTAATGATGGTTTGCTGGTCATTCTTT
GGATGTATTGGCGGTTACTTCTCCAGCAGAGTGTATGCATCTCTCGGAGGGCAGAACAAGAGGAAAAATGCATTT
TTCACGGCAACAATATTTCCAACAGCCATTTTCATTATCATCTTTATTTTGAATTTTTTCCTCATCGTTGCTGGC
TCTTCTGGGGCCGTACCATTTGGCACGATGCTCCTCATCATACTACTCTGGTTCGGAATTTCTGCACCACTGTCT
GCCATCGGTGCTTATTTCGGATCAAAGCATGGCGCTGTTAAGCATCCTGTTCGTGTAAACCCTATCCCTCGTCAA
ATCCCGCCAGGCCCCAAATACCTCAGACCTTGGGTTACTGCTATCTTAGGTGGTATCCTGCCGTTCGGTGCCGCA
TTCATTGAACTGTATTTTGTTCTCTCGAGCCTTTTCGCCTCACGAGCCTACTATGCATTCGGCTTTCTTGCCCTT
ACAGCTTCGATTGTGGCGCTTACCACGGCTACTGTCACCATCTTGTTCACGTACTTTTCCCTCTGCGCCGAAGAC
TATAGGTGGCATTGGCGTGCATTCTTGACAGGTGGTGGCAGCGCCTTCTGGTTATTTGCATATGGTTTATTCTAC
TGGGGTTCCAGAATGTCTTTGGACTCATTATCAAGTCTCCTTCTTTACCTTGGCTACCTTTTCCTTCTCGCTCTT
ATGGACTTCCTCGTGACGGGTACTATTGGCTTCCTTGCATCTTATTGGGTTGTGCGACGGTTATACACTGCCATT
CGCGTCGATTGA
Transcript >AgabiH97|046330
ATGCGTGCTCGGGCTTTTACAGTCCTTTTTATCTCGCTTCTGCCCGTCACTTCAGCCTTCTACCTGCCTGGTGCA
GCGCCGACCAATTACCGCGAGGGTGAACAAGTCCCAGTTTTCGTGAATGCCCTAACTCCCATGCTGAGCGGGAGT
GACGATCCCAAACTCAAATCACTCATTAACTACGACTACTACAATCCTAAACTTCGTTTCTGCGAGCCTGATGAT
GGTGCCCAGTCCCAACCTGAATCATTGGGCTCCATTCTTTTCGGGGACCGTCTATTCAACTCACCATATGACATC
AAGATGGTTTCAGAAAATACAACCTGCAAAATGCTTTGTCTCCAACCCAATGTTACAGGAGAAGAAGCCAAATTT
ATCAATGACAGGATTCGAGAGGACTACGCCCTCAATTGGCTCGTGGATGGACTCCCTGCTGCAGAAATGAAAGTA
GACGTCCGAAATGAAGACGTTTTCTACGATATGGGTTTCAATCTAGGAAATAATGACGGCCAATTTCAGAATCTC
CCTGTTCTCAACAACCATTATGATATAGTGCTAAGATATCATCGGCCGACACCGGATACCTATCGCGTAGTTGGG
GTCCTTGTATGGCCTTCAAGTGTTGGTGGTCCGCAGACCAATGAAGCGATATGCGACTCCGACAACGAGCTCTCC
CTTAATGAGGACCAGACCCAGGCAGTTCGGTATACATATAGAGTCACTTGGAATGAGTCCGACACTCCCTGGGCA
ACACGCTGGGATAATTATCTCCATATTTATGATCCTCGAATCCATTGGTTCAGTCTCATCAACTCCATCATCATC
GTGTTTTTCCTTTGCGGTATGGTTGGCATGATTCTACTTCGTAGCGTCTCTCGTGATATATCCCGATACAATGCC
ATTGACGTCAGCGAAGATGTGCAAGAAGACTGGGGGTGGAAGCTAGTCCATGGTGAGGTTTTCAGGACACCTCAA
AACCCCATGTTTTTGTCCATCATGGTCGGTAACGGAGTGCAACTCGTCGCGATGGTTGGGATAACCTTAGTTTTT
GCTCTCTTGGGATTCTTGTCACCTTCCAATCGCGGTTCTCTTGCGACCGTAATGATGGTTTGCTGGTCATTCTTT
GGATGTATTGGCGGTTACTTCTCCAGCAGAGTGTATGCATCTCTCGGAGGGCAGAACAAGAGGAAAAATGCATTT
TTCACGGCAACAATATTTCCAACAGCCATTTTCATTATCATCTTTATTTTGAATTTTTTCCTCATCGTTGCTGGC
TCTTCTGGGGCCGTACCATTTGGCACGATGCTCCTCATCATACTACTCTGGTTCGGAATTTCTGCACCACTGTCT
GCCATCGGTGCTTATTTCGGATCAAAGCATGGCGCTGTTAAGCATCCTGTTCGTGTAAACCCTATCCCTCGTCAA
ATCCCGCCAGGCCCCAAATACCTCAGACCTTGGGTTACTGCTATCTTAGGTGGTATCCTGCCGTTCGGTGCCGCA
TTCATTGAACTGTATTTTGTTCTCTCGAGCCTTTTCGCCTCACGAGCCTACTATGCATTCGGCTTTCTTGCCCTT
ACAGCTTCGATTGTGGCGCTTACCACGGCTACTGTCACCATCTTGTTCACGTACTTTTCCCTCTGCGCCGAAGAC
TATAGGTGGCATTGGCGTGCATTCTTGACAGGTGGTGGCAGCGCCTTCTGGTTATTTGCATATGGTTTATTCTAC
TGGGGTTCCAGAATGTCTTTGGACTCATTATCAAGTCTCCTTCTTTACCTTGGCTACCTTTTCCTTCTCGCTCTT
ATGGACTTCCTCGTGACGGGTACTATTGGCTTCCTTGCATCTTATTGGGTTGTGCGACGGTTATACACTGCCATT
CGCGTCGATTGA
Gene >AgabiH97|046330
ATGCGTGCTCGGGCTTTTACAGTCCTTTTTATCTCGCTTCTGCCCGTCACTTCAGCCTTCTACCTGCCTGGTGCA
GCGCCGACCAATTACCGCGAGGGTGAACAAGTCCCAGTTTTCGTGAATGCCCTAACTCCCATGCTGAGCGGGAGT
GACGATCCCAAACTCGTATGTCATCCCTCAGGCATGCCGAAATATTCATCTAATGTTGTCATAGAAATCACTCAT
TAACTGTGCGTAAGCTTTAATAGTACCAACGAAGAATATATACCCTAATATTCTCACAGACGACTACTACAATCC
TAAACTTCGTTTCTGCGAGCCTGATGATGGTGCCCAGTCCCAACCTGAATCATTGGGCTCCATTCTTTTCGGGGA
CCGTCTATTCAACTCACCATATGACGTACGTAGCTACAGTCACTTGTACATCTGCTTGAAATGGCTTATATCTCG
ATAGATCAAGATGGTTTCAGAAAATACAACCTGCAAAATGCTTTGTCTCCAACCCAATGTTACAGGAGAAGAAGC
CAAATTTATCAATGACAGGATTCGAGAGGACTACGCCCTCAATTGGCTCGTGGATGGACTCCCTGCTGCAGAAAT
GAAAGTAGACGTCCGAAATGAAGACGTTTTCTACGATATGGGTTTCAATCTAGGAAATAATGACGGCCAATTTCA
GAATCTCCCTGTTCTCAACAACCATTATGATATAGTGCTAAGGTATGATTATTCCTGGAGGTCACGGTCTCGTTG
GGAGGTCTCAAGAATTTCAGATATCATCGGCCGACACCGGATACCTATCGCGTAGTTGGGGTCCTTGTATGGCCT
TCAAGGTGTGCTGACATTGTTGCAACAATTTGGTCCGGGATATATTGACAATACATTAGTGTTGGTGGTCCGCAG
ACCAATGAAGCGATATGCGACTCCGACAACGAGCTCTCCCTTAATGAGGACCAGACCCAGGCAGTTCGGTATACA
TATAGAGTCACTTGGAATGTAAGTCGCCACGTGGCTTCTTGTGCATGAACGACTAACAAGTTGTAGGAGTCCGAC
ACTCCCTGGGTATGTTATTGCAATAAATTAAGCCCAGATTCTTCGTTAAAAGCATGCTTCGTAGGCAACACGCTG
GGATAATTATCTCCATATTTATGATCCTCGAATCCATTGGTTCAGTCTCATCAACTCCATCATCATCGTGTTTTT
CCTTTGCGGTATGGTTGGCATGATTCTACTTCGTAGCGTCTCTCGTGATGTCAGTAATGTTTTCGACATCGCCAT
CACCACTGTTCTCACCTTTCATACTAGATATCCCGATACAATGCCATTGACGTCAGCGTAAGTCGAATGCTGCGG
AAGTTAGTTGCATTTTTGATATTGGTGTTTTAGGAAGATGTGCAAGAAGACTGGGGGTGGAAGCTAGTCCATGGT
GAGGTTTTCAGGACACCTCAAAACCCCATGTTTTTGTCCATCATGGTCGGTAACGGAGTGCAACTCGTCGCGATG
GTTGGGATAACCTTAGGTAAATTTTAGCCATTTCACAAACGGGATCAAAATTAAACGAAGGTTTCTGGTAGTTTT
TGCTCTCTTGGGATTCTTGTCACCTTCCAATCGCGGTTCTCTTGCGACCGTAATGATGGTTTGCTGGTCATTCTT
TGGATGGTTGGTTACGTGTGCTTAGTTTGCCAATGCTTGATGGTTGATTTTGTTTACCAGTATTGGCGGTTACTT
CTCCAGCAGAGTGTATGCATCTCTCGGAGGGCAGAACAAGAGGAAAAATGCATTTTTCACGGCAACAATATTTCC
AACGTGGGTGCTGCAGATATTGTCTTAGAAGACCGAATTTAATAAAATTTTAGAGCCATTTTCATTATCATCTTT
ATTTTGAATTTTTTCCTCATCGTTGCTGGCTCTTCTGGGGCCGTACCATTTGGTGGCTAACAAATTTTATCCTTG
GAAATGACGCGGAAGATCTAACGCTGTCTAGGCACGATGCTCCTCATCATACTACTCTGGTTCGGAATTTCTGCA
CCACTGTCTGCCATCGGTGCTTATTTCGGATCAAAGCATGGCGTATGTATGCTCTTTGTTCGACGAGCTCTATGC
TGATCCCAAAACCAAGGCTGTTAAGCATCCTGTTCGTGTAAACCCTATCCCTCGTCAAATCCCGCCAGGCCCCAA
ATACCTCAGACCTTGGGTAAGCACTAAATGACAGGTCTGTATATCATATCTATTTACAGCGTGAATTGGTCAGGT
TACTGCTATCTTAGGTGGTATCCTGCCGTTCGGTAAGTGACGACATGCTCGTCCTTCTTTCCTTATGTTCATTCC
AATTTATAGGTGCCGCATTCATTGAACTGTATTTTGTTCTCTCGAGCCTTTTCGCCTCACGAGCCTACTATGCAT
TCGGCTTTCTTGCCCTTACAGCTTCGATTGTGGCGCTTACCACGGCTACTGTCACCATCTTGTTCACGTACTTTT
CCCTCTGCGCCGAAGACTATAGGTAAGTCTTCGATGCTTCAAAAATATGATTTCCTTTTATTCAATATACGACAG
GTGGCATTGGCGTGCATTCTTGACAGGTGGTGGCAGCGCCTTCTGGTTATTTGCATATGGTTTATTCTACTGGGG
TTCCAGAATGTCTTTGGACTCATTATCAAGTCTCCTTCTTTACCTTGGCTACCTTTTCCTTCTCGCTCTTATGGA
CTTCCTCGTGACGGGTACTATTGGCTTCCTTGCATCTTATTGGGTTGTGCGACGGTTATACACTGCCATTCGCGT
CGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail