Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046290
Gene name
Locationscaffold_2:1922495..1926053
Strand+
Gene length (bp)3558
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09451 ATG27 Autophagy-related protein 27 1.1E-59 158 418
PF17390 Bac_rhamnosid_C Bacterial alpha-L-rhamnosidase C-terminal domain 2.2E-05 66 123
PF01693 Cauli_VI Caulimovirus viroplasmin 1.9E-04 468 509

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6CBS9|ATG27_YARLI Autophagy-related protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG27 PE=3 SV=1 158 422 1.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 350 372 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046290
MLYTNLSVQSTLLEGFTANGSLGYRAAAGYDFDHSYTSHSHGWATGPTPAMTFHILGIGITSPQGKTWSISPVLS
GLQSAEGGLETGLGWFGVKWEVSDSMLSVAVSTPLGTSGTVRLPGEGPVTVDGIVQTGINVDFALFSSLDAQRQL
FLANGWTLAEEQAAFDCHVATEGANFDLTGLSGEHTLNRTRNTPPTKMVDSLRFNLCSDLKPQEDVAEGDQCPKG
ARACLTSVNQKSQESDRIISVITLAMASSTRSVTAGLSDPKFISILFAGPEYSSPSESTPTKQFLNVTVHCDPNS
KSDPIFLSYDDSLLALEWRAPGGCPSEQSPEPPKDHDDKDDPKEENVGSGLGWFFLVILLAFVAYFGLGAYYNYS
TYGARGKDLIPHRDFWQEVPYMLKDVISHLCSSVHPRRSSRGGYVALMNNNDLILRENASKNDLGSAMTLCRSYC
PKRRKHINAKALLPMVKKYYVIIVGVDPGVYFDYWVEVAPLVKNHPSSIYQKVETEEEAWRLFENASLKGQVRAL
SFPPGSTASPGSQTTSTRKSPSSSVSNAHHSSPTPASKLTRSRSDTQARNGASPGRFNLRDPNTVSAAGRTTTSL
NRVITLSKTHSEPNPTASAFDSLKKVYVQQHTASNGIEASSNVDVPNTPFRTRVESPPWLASYPDDEIESSISSI
SPALGPIASPVISSRSFGPCSPVPFSTPRHDREAVEHTGYDSSEPVKSPTPSFRRREVRGSRNCGIDQTTESKLN
AASGGLSKNSRCNGEVPKFQGDVDPFVQLVVDEVLKRLRPSPRVEDELLPDSSSKRPSRPNGHNSNARSERQNGR
KEVSSPGSHSQRSAPSPTSGAKSLLSPGAPNGSVLFHRSRDNSGSFRNGPLKRNGLCQQCNGTGYDVGVAVSVLD
EAGLNQPNLAPFQPYDTVQDPRSPLITGLKKLASPFTFRRPSPIVSKNLSANTSF*
Coding >AgabiH97|046290
ATGTTGTACACCAACTTGTCGGTGCAGTCCACCCTGCTTGAGGGATTCACCGCCAACGGTTCATTGGGATATCGC
GCAGCAGCAGGCTACGACTTTGATCATTCATACACGAGCCATAGCCACGGCTGGGCAACAGGTCCGACTCCGGCT
ATGACGTTCCATATCCTCGGAATTGGAATAACGTCTCCTCAAGGAAAAACATGGAGCATAAGTCCTGTCCTGAGT
GGGCTTCAATCTGCTGAGGGAGGCCTAGAAACGGGGCTCGGATGGTTTGGAGTGAAGTGGGAAGTGAGCGACAGT
ATGCTGAGTGTGGCGGTCTCAACCCCACTTGGAACATCGGGGACGGTGAGGCTGCCTGGGGAGGGGCCGGTGACG
GTGGACGGAATAGTACAGACAGGAATCAATGTCGACTTTGCTCTGTTCTCGAGTCTCGACGCTCAACGTCAACTC
TTCCTTGCTAATGGCTGGACCTTGGCAGAGGAACAGGCTGCATTCGATTGTCATGTCGCCACTGAGGGCGCAAAC
TTTGATTTGACAGGGCTCTCTGGCGAGCATACGTTAAACCGGACAAGGAACACACCGCCAACGAAGATGGTGGAT
TCCCTGCGGTTCAATCTCTGCTCAGACCTCAAACCCCAGGAGGACGTTGCGGAAGGCGACCAATGTCCTAAAGGA
GCCCGTGCTTGTTTGACTAGTGTGAATCAGAAATCTCAAGAATCCGATCGTATAATTTCAGTCATCACCCTTGCA
ATGGCTTCCTCTACACGCTCCGTAACCGCTGGACTGTCTGATCCCAAATTCATCTCTATCTTGTTTGCCGGCCCC
GAGTACTCGTCACCCTCTGAGTCTACTCCAACAAAACAGTTTCTGAACGTCACGGTACATTGTGACCCGAATTCA
AAGTCTGATCCCATTTTTCTCTCCTACGACGACTCGTTGCTCGCTTTAGAATGGCGGGCGCCCGGTGGTTGTCCA
TCCGAACAAAGTCCAGAGCCTCCGAAAGACCATGATGACAAGGATGATCCTAAGGAAGAGAATGTAGGCAGTGGG
CTGGGATGGTTCTTCTTAGTAATACTCTTGGCATTCGTGGCTTATTTTGGTCTGGGAGCTTACTATAACTATTCG
ACATATGGTGCTAGAGGCAAAGACCTTATTCCACACCGAGATTTCTGGCAGGAAGTGCCCTATATGCTCAAGGAC
GTTATCTCCCATCTTTGTTCGTCAGTGCATCCACGGCGATCATCCAGAGGGGGCTATGTTGCTTTAATGAATAAT
AATGACTTGATTCTTCGAGAAAATGCGTCGAAGAACGATCTAGGGAGTGCTATGACGTTATGTCGAAGCTACTGC
CCGAAAAGGAGGAAACATATCAACGCGAAGGCGCTGCTCCCAATGGTGAAGAAATACTATGTCATTATCGTTGGA
GTCGATCCTGGTGTATATTTCGACTATTGGGTAGAAGTCGCGCCTCTGGTGAAGAATCACCCGAGTTCTATTTAC
CAAAAGGTGGAGACTGAGGAAGAGGCGTGGAGGCTGTTTGAGAATGCTAGCCTTAAAGGACAGGTTCGAGCCCTG
TCGTTTCCGCCCGGCTCAACCGCCTCGCCTGGGTCTCAGACCACTTCAACACGGAAGTCGCCAAGTAGTTCGGTT
TCCAATGCCCACCACTCGTCGCCTACACCTGCCTCCAAACTGACTAGGTCTCGTTCTGATACGCAAGCGCGGAAT
GGTGCTTCTCCTGGACGCTTCAACTTGAGGGACCCGAATACTGTCTCTGCAGCTGGGAGAACGACCACCAGTCTA
AATCGCGTGATAACTCTTTCAAAAACTCATTCTGAACCAAATCCTACTGCGTCCGCATTTGACTCCCTAAAAAAG
GTTTATGTACAACAGCACACTGCCTCGAATGGAATAGAAGCGTCCTCAAATGTCGATGTACCCAACACGCCATTT
CGTACCAGGGTGGAATCACCGCCTTGGTTAGCGTCATACCCAGACGATGAAATTGAATCATCTATATCATCTATT
TCGCCTGCCTTAGGTCCTATAGCTTCCCCAGTCATTTCATCCAGGTCATTCGGGCCCTGTAGCCCTGTACCTTTC
TCCACACCTCGACATGACAGGGAAGCTGTGGAACATACTGGTTATGATTCTTCCGAGCCGGTGAAGTCACCCACA
CCTTCTTTCCGTCGGCGGGAGGTTCGGGGAAGCAGGAATTGCGGAATAGATCAGACAACTGAAAGCAAGTTGAAT
GCAGCATCAGGAGGATTGTCAAAGAATTCCCGTTGTAATGGAGAAGTTCCTAAATTTCAAGGCGACGTGGATCCA
TTCGTTCAGCTTGTTGTTGACGAAGTCTTGAAGCGCCTCCGTCCTTCCCCCAGGGTTGAGGATGAGTTGTTGCCT
GACAGTAGCTCAAAGCGCCCTTCTAGGCCAAACGGCCATAATAGCAACGCTCGGTCAGAGAGGCAGAATGGAAGG
AAGGAAGTTTCATCCCCAGGCTCACATTCACAAAGAAGCGCGCCATCACCCACCTCAGGAGCAAAAAGCTTGCTT
AGTCCAGGTGCACCTAATGGTTCTGTTTTGTTCCACCGCAGCCGTGATAACTCGGGGTCCTTTAGAAATGGTCCT
CTGAAACGAAACGGACTTTGTCAACAATGCAACGGAACAGGCTATGATGTCGGAGTTGCTGTCTCTGTTTTAGAT
GAAGCAGGGTTGAATCAACCGAATCTCGCTCCCTTTCAGCCGTATGATACTGTCCAGGATCCCAGGTCACCACTG
ATCACAGGCTTGAAGAAACTGGCGAGCCCTTTCACATTTCGTCGACCTTCGCCTATCGTCTCGAAAAATTTATCT
GCAAACACGAGTTTTTGA
Transcript >AgabiH97|046290
ATGTTGTACACCAACTTGTCGGTGCAGTCCACCCTGCTTGAGGGATTCACCGCCAACGGTTCATTGGGATATCGC
GCAGCAGCAGGCTACGACTTTGATCATTCATACACGAGCCATAGCCACGGCTGGGCAACAGGTCCGACTCCGGCT
ATGACGTTCCATATCCTCGGAATTGGAATAACGTCTCCTCAAGGAAAAACATGGAGCATAAGTCCTGTCCTGAGT
GGGCTTCAATCTGCTGAGGGAGGCCTAGAAACGGGGCTCGGATGGTTTGGAGTGAAGTGGGAAGTGAGCGACAGT
ATGCTGAGTGTGGCGGTCTCAACCCCACTTGGAACATCGGGGACGGTGAGGCTGCCTGGGGAGGGGCCGGTGACG
GTGGACGGAATAGTACAGACAGGAATCAATGTCGACTTTGCTCTGTTCTCGAGTCTCGACGCTCAACGTCAACTC
TTCCTTGCTAATGGCTGGACCTTGGCAGAGGAACAGGCTGCATTCGATTGTCATGTCGCCACTGAGGGCGCAAAC
TTTGATTTGACAGGGCTCTCTGGCGAGCATACGTTAAACCGGACAAGGAACACACCGCCAACGAAGATGGTGGAT
TCCCTGCGGTTCAATCTCTGCTCAGACCTCAAACCCCAGGAGGACGTTGCGGAAGGCGACCAATGTCCTAAAGGA
GCCCGTGCTTGTTTGACTAGTGTGAATCAGAAATCTCAAGAATCCGATCGTATAATTTCAGTCATCACCCTTGCA
ATGGCTTCCTCTACACGCTCCGTAACCGCTGGACTGTCTGATCCCAAATTCATCTCTATCTTGTTTGCCGGCCCC
GAGTACTCGTCACCCTCTGAGTCTACTCCAACAAAACAGTTTCTGAACGTCACGGTACATTGTGACCCGAATTCA
AAGTCTGATCCCATTTTTCTCTCCTACGACGACTCGTTGCTCGCTTTAGAATGGCGGGCGCCCGGTGGTTGTCCA
TCCGAACAAAGTCCAGAGCCTCCGAAAGACCATGATGACAAGGATGATCCTAAGGAAGAGAATGTAGGCAGTGGG
CTGGGATGGTTCTTCTTAGTAATACTCTTGGCATTCGTGGCTTATTTTGGTCTGGGAGCTTACTATAACTATTCG
ACATATGGTGCTAGAGGCAAAGACCTTATTCCACACCGAGATTTCTGGCAGGAAGTGCCCTATATGCTCAAGGAC
GTTATCTCCCATCTTTGTTCGTCAGTGCATCCACGGCGATCATCCAGAGGGGGCTATGTTGCTTTAATGAATAAT
AATGACTTGATTCTTCGAGAAAATGCGTCGAAGAACGATCTAGGGAGTGCTATGACGTTATGTCGAAGCTACTGC
CCGAAAAGGAGGAAACATATCAACGCGAAGGCGCTGCTCCCAATGGTGAAGAAATACTATGTCATTATCGTTGGA
GTCGATCCTGGTGTATATTTCGACTATTGGGTAGAAGTCGCGCCTCTGGTGAAGAATCACCCGAGTTCTATTTAC
CAAAAGGTGGAGACTGAGGAAGAGGCGTGGAGGCTGTTTGAGAATGCTAGCCTTAAAGGACAGGTTCGAGCCCTG
TCGTTTCCGCCCGGCTCAACCGCCTCGCCTGGGTCTCAGACCACTTCAACACGGAAGTCGCCAAGTAGTTCGGTT
TCCAATGCCCACCACTCGTCGCCTACACCTGCCTCCAAACTGACTAGGTCTCGTTCTGATACGCAAGCGCGGAAT
GGTGCTTCTCCTGGACGCTTCAACTTGAGGGACCCGAATACTGTCTCTGCAGCTGGGAGAACGACCACCAGTCTA
AATCGCGTGATAACTCTTTCAAAAACTCATTCTGAACCAAATCCTACTGCGTCCGCATTTGACTCCCTAAAAAAG
GTTTATGTACAACAGCACACTGCCTCGAATGGAATAGAAGCGTCCTCAAATGTCGATGTACCCAACACGCCATTT
CGTACCAGGGTGGAATCACCGCCTTGGTTAGCGTCATACCCAGACGATGAAATTGAATCATCTATATCATCTATT
TCGCCTGCCTTAGGTCCTATAGCTTCCCCAGTCATTTCATCCAGGTCATTCGGGCCCTGTAGCCCTGTACCTTTC
TCCACACCTCGACATGACAGGGAAGCTGTGGAACATACTGGTTATGATTCTTCCGAGCCGGTGAAGTCACCCACA
CCTTCTTTCCGTCGGCGGGAGGTTCGGGGAAGCAGGAATTGCGGAATAGATCAGACAACTGAAAGCAAGTTGAAT
GCAGCATCAGGAGGATTGTCAAAGAATTCCCGTTGTAATGGAGAAGTTCCTAAATTTCAAGGCGACGTGGATCCA
TTCGTTCAGCTTGTTGTTGACGAAGTCTTGAAGCGCCTCCGTCCTTCCCCCAGGGTTGAGGATGAGTTGTTGCCT
GACAGTAGCTCAAAGCGCCCTTCTAGGCCAAACGGCCATAATAGCAACGCTCGGTCAGAGAGGCAGAATGGAAGG
AAGGAAGTTTCATCCCCAGGCTCACATTCACAAAGAAGCGCGCCATCACCCACCTCAGGAGCAAAAAGCTTGCTT
AGTCCAGGTGCACCTAATGGTTCTGTTTTGTTCCACCGCAGCCGTGATAACTCGGGGTCCTTTAGAAATGGTCCT
CTGAAACGAAACGGACTTTGTCAACAATGCAACGGAACAGGCTATGATGTCGGAGTTGCTGTCTCTGTTTTAGAT
GAAGCAGGGTTGAATCAACCGAATCTCGCTCCCTTTCAGCCGTATGATACTGTCCAGGATCCCAGGTCACCACTG
ATCACAGGCTTGAAGAAACTGGCGAGCCCTTTCACATTTCGTCGACCTTCGCCTATCGTCTCGAAAAATTTATCT
GCAAACACGAGTTTTTGA
Gene >AgabiH97|046290
ATGTTGTACACCAACTTGTCGGTGCAGTCCACCCTGCTTGAGGGATTCACCGCCAACGGTTCATTGGGGTGAGTT
CAGAGAGTCAAATGACACTTGCTCTGGCTTAGTGGCCATTCAGATATCGCGCAGCAGCAGGCTACGACTTTGATC
ATTCATACACGAGCCATAGCCACGGCTGGGCAACAGGTCCGACTCCGGCTATGACGTTCCATATCCTCGGAATTG
GAATAACGTCTCCTCAAGGAAAAACATGGAGCATAAGTCCTGTCCTGAGTGGGCTTCAATCTGCTGAGGGAGGCC
TAGAAACGGGGCTCGGATGGTTTGGAGTGAAGTGGGAAGTGAGCGACAGTATGCTGAGTGTGGCGGTCTCAACCC
CACTTGGAACATCGGGGACGGTGAGGCTGCCTGGGGAGGGGCCGGTGACGGTGGACGGAATAGTACAGACAGGAA
TCAATGTCGAGTTGAGCGGAGGCGAGCACGTCCTGACGAGGCATGTGTAGTCACGTGATATGAATCATAACTAGC
TTTGCTCTGTTCTCGAGTCTCGACGCTCAACGTCAACTCTTCCTTGCTAATGGTCCGCTGGGGCTCGCTCCCGTG
CTCGTCCCTTCTAACAGCCATCGTTTATCTCCTGCTGCTGCCAGGCTGGACCTTGGCAGAGGAACAGGCTGCATT
CGATTGTCATGTCGCCACTGAGGGCGCAAACTTTGATTTGACAGGGCTCTCTGGCGAGCATACGTTAAACCGGAC
AAGGAACACACCGCCAACGAAGATGGTGGATTCCCTGCGGTTCAATCTCTGCTCAGACCTCAAACCCCAGGAGGA
CGTTGCGGAAGGCGACCAAGTGGGTGGTAGACAATGAGTCTGGTATCTCCTCTTTGCTCATCTTCATTGCACCTA
GTGTCCTAAAGGAGCCCGTGCTTGTTTGACTAGTGTGAATCAGAAATCTCAAGAATCCGATCGTATAATTTCAGT
CATCACCCTTGCAATGGCTTCCTCTACACGCTCCGTAACCGCTGGACTGTCTGGTCAGTGATCTGAATTGAAAGT
TCTTTCTATTCCCGCTCAAAAGAAAAACTTGGGTATTCAGATCCCAAATTCATCTCTATCTTGTTTGCCGGCCCC
GAGTACTCGTCACCCTCTGAGTCTACTCCAACAAAACAGTTTCTGAACGTCACGGTACATTGTGACCCGAATTCA
AAGTCTGATCCCATTTTTCTCTCCTACGACGACTCGTTGCTCGCTTTAGAATGGCGGGCGCCCGGTGGTTGTCCA
TCCGAACAAAGTCCAGAGCCTCCGAAAGACCATGATGACAAGGATGATCCTAAGGAAGAGAATGTAGGCAGTGGG
CTGGGATGGTTCTTCTTAGTGTACGCGATTCCATTCCATTTCGCGATGACTTTCTGTCCTCATAATTTTGCGCAG
AATACTCTTGGCATTCGTGGCTTATTTTGGTCTGGGAGCTTACTATAACTATTCGACATATGGTGCTAGAGGCAA
AGACCTTATTCCGTGGGTCCATTCCCTTCAGTCACTCGCCCTACTGACATGACCTCTTGTTAGACACCGAGATTT
CTGGCAGGAAGTGCCCTATATGCTCAAGGACGTTATCTCCCATCTTTGTTCGTCAGTGCATCCACGGCGATCATC
CAGAGGGGGCTATGTTGCTGTATGAGTGTCTGCAAGGATGAAGGGTCAGTAGTGCTGCGACGGAGAAATGGTTTA
TTGGACTAGCTTATAGGGTAGTTTTGTAGTTAATGAATAATAATGACTTGATTCTTCGAGAAAATGCGTCGAAGA
ACGATCTAGGGAGTGCTATGACGTTATGTCGAAGCTACTGCCCGAAAAGGAGGAAACATATCAACGCGAAGGCGC
TGGTCTGTTCTTTGCTCCCACGTCTCTCCTTGACCGTTATCGTCCGAGTGTAAGCTCCCAATGGTGAAGAAATAC
TATGTCATTATCGTTGGAGTCGATCCTGGTGTATATTTCGACTATTGGTGTGTTCTAATTCAAGTCCTGTGTCTG
TATTCTTTTTGACATTGCTTCAGGGTAGAAGTCGCGCCTCTGGTGAAGAATCACCCGAGTTCTATTTACCAAAAG
GTGGAGACTGAGGAAGAGGCGTGGAGGCTGTTTGAGAATGCTAGCCTTAAAGGACAGGTTCGAGCCCTGTCGTTT
CCGCCCGGCTCAACCGCCTCGCCTGGGTCTCAGACCACTTCAACACGGAAGTCGCCAAGTAGTTCGGTTTCCAAT
GCCCACCACTCGTCGCCTACACCTGCCTCCAAACTGACTAGGTCTCGTTCTGATACGCAAGCGCGGAATGGTGCT
TCTCCTGGACGCTTCAACTTGAGGGACCCGAATACTGTCTCTGCAGCTGGGAGAACGACCACCAGTCTAAATCGC
GTGATAACTCTTTCAAAAACTCATTCTGAACCAAATCCTACTGCGTCCGCATTTGACTCCCTAAAAAAGGTTTAT
GTACAACAGCACACTGCCTCGAATGGAATAGAAGCGTCCTCAAATGTCGATGTACCCAACACGCCATTTCGTACC
AGGGTGGAATCACCGCCTTGGTTAGCGTCATACCCAGACGATGAAATTGAATCATCTATATCATCTATTTCGCCT
GCCTTAGGTCCTATAGCTTCCCCAGTCATTTCATCCAGGTCATTCGGGCCCTGTAGCCCTGTACCTTTCTCCACA
CCTCGACATGACAGGGAAGCTGTGGAACATACTGGTTATGATTCTTCCGAGCCGGTGAAGTCACCCACACCTTCT
TTCCGTCGGCGGGAGGTTCGGGGAAGCAGGAATTGCGGAATAGATCAGACAACTGAAAGCAAGTTGAATGCAGCA
TCAGGAGGATTGTCAAAGAATTCCCGTTGTAATGGAGAAGTTCCTAAATTTCAAGGCGACGTGGATCCATTCGTT
CAGCTTGTTGTTGACGAAGTCTTGAAGCGCCTCCGTCCTTCCCCCAGGGTTGAGGATGAGTTGTTGCCTGACAGT
AGCTCAAAGCGCCCTTCTAGGCCAAACGGCCATAATAGCAACGCTCGGTCAGAGAGGCAGAATGGAAGGAAGGAA
GTTTCATCCCCAGGCTCACATTCACAAAGAAGCGCGCCATCACCCACCTCAGGAGCAAAAAGCTTGCTTAGTCCA
GGTGCACCTAATGGTTCTGTTTTGTTCCACCGCAGCCGTATGTTTCTTCTGTGCGCCAGATTGCGTTGACTAAAG
AAGATCCCTAGGTGATAACTCGGGGTCCTTTAGAAATGGTCCTCTGAAACGAAACGGACTTTGTCAACAATGCAA
CGGAACAGGCTATGATGTCGGAGTTGCTGTCTCTGTTTTAGATGAAGCAGGGTTGAATCAACCGAATCTCGCTCC
CTTTCAGCCGTATGATACTGTCCAGGATCCCAGGTCACCACTGATCACAGGCTTGAAGAAACTGGCGAGGTTCGT
TTTCCTCTGTTAAAAGTCGCCCAATGACTCAACCCGCTTAGCCCTTTCACATTTCGTCGACCTTCGCCTATCGTC
TCGAAAAATTTATCTGCAAACACGAGTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail