Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046260
Gene name
Locationscaffold_2:1913961..1916085
Strand+
Gene length (bp)2124
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 3.2E-11 437 482
PF17123 zf-RING_11 RING-like zinc finger 2.7E-07 438 467
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 7.4E-06 437 486

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 431 484 1.0E-10
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 401 482 4.0E-10
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 436 500 4.0E-10
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 433 486 5.0E-10
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 437 490 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 431 484 1.0E-10
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 401 482 4.0E-10
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 436 500 4.0E-10
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 433 486 5.0E-10
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 437 490 5.0E-10
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 437 484 2.0E-09
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 437 484 3.0E-09
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 437 484 4.0E-09
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 429 486 4.0E-09
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 436 493 4.0E-09
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 436 483 5.0E-09
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 436 483 5.0E-09
sp|Q9ZV53|ATL49_ARATH Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana GN=ATL49 PE=3 SV=1 438 487 7.0E-09
sp|Q9FHG8|ATL50_ARATH Putative RING-H2 finger protein ATL50 OS=Arabidopsis thaliana GN=ATL50 PE=3 SV=1 421 482 7.0E-09
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 436 483 8.0E-09
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 436 483 9.0E-09
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 438 485 9.0E-09
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 436 483 9.0E-09
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 436 483 9.0E-09
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 436 483 1.0E-08
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 436 493 1.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 436 493 1.0E-08
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 436 483 1.0E-08
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 436 483 1.0E-08
sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 438 483 1.0E-08
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 438 484 1.0E-08
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 436 493 1.0E-08
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 437 484 1.0E-08
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 436 493 2.0E-08
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 423 490 2.0E-08
sp|Q9P7E1|YOF7_SCHPO Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.07 PE=1 SV=1 408 489 3.0E-08
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 438 501 3.0E-08
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 438 485 4.0E-08
sp|Q9LM69|ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana GN=ATL80 PE=2 SV=1 429 487 7.0E-08
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 420 503 7.0E-08
sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 396 496 8.0E-08
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 438 484 1.0E-07
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 438 484 1.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 438 484 1.0E-07
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 438 485 1.0E-07
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 438 485 1.0E-07
sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 402 483 1.0E-07
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 438 484 1.0E-07
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 436 570 2.0E-07
sp|Q8BGI1|RNF24_MOUSE RING finger protein 24 OS=Mus musculus GN=Rnf24 PE=2 SV=1 436 502 2.0E-07
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 438 486 2.0E-07
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 438 486 3.0E-07
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 438 486 3.0E-07
sp|Q14B02|RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus GN=Rnf133 PE=1 SV=1 427 531 3.0E-07
sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 427 485 3.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 438 486 3.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 438 486 3.0E-07
sp|Q8LC69|ATL8_ARATH RING-H2 finger protein ATL8 OS=Arabidopsis thaliana GN=ATL8 PE=2 SV=2 429 487 3.0E-07
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 438 501 4.0E-07
sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 427 531 4.0E-07
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 396 513 4.0E-07
sp|Q8LBA0|NIPL2_ARATH NEP1-interacting protein-like 2 OS=Arabidopsis thaliana GN=ATL24 PE=1 SV=2 428 483 5.0E-07
sp|Q9SZL4|ATL18_ARATH RING-H2 finger protein ATL18 OS=Arabidopsis thaliana GN=ATL18 PE=2 SV=1 438 487 5.0E-07
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 434 511 5.0E-07
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 428 502 6.0E-07
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 424 486 6.0E-07
sp|Q9DBU5|RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus GN=Rnf6 PE=1 SV=1 436 489 7.0E-07
sp|Q67YI6|ATL65_ARATH RING-H2 finger protein ATL65 OS=Arabidopsis thaliana GN=ATL65 PE=2 SV=2 438 493 7.0E-07
sp|Q9Y225|RNF24_HUMAN RING finger protein 24 OS=Homo sapiens GN=RNF24 PE=1 SV=1 436 496 8.0E-07
sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 436 481 8.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 423 499 8.0E-07
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 436 519 8.0E-07
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 436 519 9.0E-07
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 436 486 1.0E-06
sp|Q9C7E9|ATL20_ARATH RING-H2 finger protein ATL20 OS=Arabidopsis thaliana GN=ATL20 PE=2 SV=2 438 482 1.0E-06
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 436 519 1.0E-06
sp|Q6NML0|ATL76_ARATH E3 ubiquitin-protein ligase ATL76 OS=Arabidopsis thaliana GN=ATL76 PE=1 SV=1 436 511 2.0E-06
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 438 490 2.0E-06
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 436 505 2.0E-06
sp|Q9SUS4|RHA1A_ARATH RING-H2 zinc finger protein RHA1a OS=Arabidopsis thaliana GN=RHA1A PE=2 SV=1 436 486 2.0E-06
sp|Q9M313|ATL68_ARATH RING-H2 finger protein ATL68 OS=Arabidopsis thaliana GN=ATL68 PE=2 SV=1 434 483 2.0E-06
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 438 483 2.0E-06
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 433 488 2.0E-06
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 438 485 3.0E-06
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 438 485 3.0E-06
sp|Q9QYK7|RNF11_MOUSE RING finger protein 11 OS=Mus musculus GN=Rnf11 PE=1 SV=1 438 495 3.0E-06
sp|Q9Y3C5|RNF11_HUMAN RING finger protein 11 OS=Homo sapiens GN=RNF11 PE=1 SV=1 438 495 3.0E-06
sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus GN=RNF11 PE=2 SV=1 438 495 3.0E-06
sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 400 483 3.0E-06
sp|O82353|ATL67_ARATH RING-H2 finger protein ATL67 OS=Arabidopsis thaliana GN=ATL67 PE=2 SV=1 437 483 3.0E-06
sp|P0C034|ATL10_ARATH RING-H2 finger protein ATL10 OS=Arabidopsis thaliana GN=ATL10 PE=2 SV=1 436 482 3.0E-06
sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 422 485 3.0E-06
sp|Q9SUS5|RHA1B_ARATH E3 ubiquitin-protein ligase RHA1B OS=Arabidopsis thaliana GN=RHA1B PE=2 SV=1 436 486 4.0E-06
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 438 487 4.0E-06
sp|Q9ZV51|ATL56_ARATH RING-H2 finger protein ATL56 OS=Arabidopsis thaliana GN=ATL56 PE=2 SV=1 438 503 4.0E-06
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 432 485 4.0E-06
sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus GN=Rnf122 PE=2 SV=1 436 483 5.0E-06
sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens GN=RNF122 PE=2 SV=2 436 483 5.0E-06
sp|Q9D9X6|ZSWM2_MOUSE E3 ubiquitin-protein ligase Zswim2 OS=Mus musculus GN=Zswim2 PE=1 SV=1 438 483 5.0E-06
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 438 501 5.0E-06
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 438 486 5.0E-06
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 438 482 5.0E-06
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 432 485 5.0E-06
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 432 485 5.0E-06
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 438 486 5.0E-06
sp|Q9LRB7|EL5_ORYSJ E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica GN=EL5.1 PE=1 SV=1 438 482 5.0E-06
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 432 485 5.0E-06
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 436 486 6.0E-06
sp|Q63364|PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus GN=Pja2 PE=2 SV=1 432 485 6.0E-06
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 438 485 6.0E-06
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 436 486 6.0E-06
sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 438 482 7.0E-06
sp|Q9M0C3|ATL14_ARATH RING-H2 finger protein ATL14 OS=Arabidopsis thaliana GN=ATL14 PE=2 SV=1 434 482 7.0E-06
sp|P0CH03|AT21C_ARATH Putative RING-H2 finger protein ATL21C OS=Arabidopsis thaliana GN=ATL21C PE=3 SV=1 437 483 7.0E-06
sp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1 438 487 7.0E-06
sp|P0CH01|AT21A_ARATH Putative RING-H2 finger protein ATL21A OS=Arabidopsis thaliana GN=ATL21A PE=3 SV=1 437 482 8.0E-06
sp|Q8NG27|PJA1_HUMAN E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens GN=PJA1 PE=1 SV=2 432 485 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005575 cellular_component No
GO:0140535 intracellular protein-containing complex No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1990234 transferase complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0030163 protein catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0032991 protein-containing complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0044260 cellular macromolecule metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0004842 ubiquitin-protein transferase activity No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0010498 proteasomal protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0005515 protein binding No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0140513 nuclear protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 246 268 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046260
MVLLLLLLAALAAAYIPASPTNSTQDAIAGGLNITDISKLRLQWYSNGNYVENISYQLAGNGTSGISKGILIHFS
EESVNETIPPTSAPWIAMVSCDANATDASMDVDIFTLARDKGAVAALLYSLRSLACVINPEYANPATFDQVFDIF
STQSKTSARLIDYQFGQLAPANSSITKYDSQRLNNTAEAVRDSIQAGHATRPGFLYAELRAYNATGDTNDPVVTG
SNSGDSTGSGTGSKNTALAMIVLYAITGCVSALFCIVIVSGAVRALRHPERYGPRARIGLDGPPQGRARGLTRAI
LDTFPIVKFGGSRDRPVDSAMDTANSIKDMEAQDISQWELLDITDAKRESTFKLDEVNATAGCTASQAIEIDDEK
TRLSRSSTPGPCSPQILPSREEDRGEGSSTPKPTSSKPQLSDKPGMMPVRHDLSPEAMGRETCPICIVDFEKGDD
IRVLPCEGNHRFHPECVDQWLLQLSSSCPICRQDFMALADMMSYEDDRESQELGIDGFEPDSPDEDRRSYHQSLS
PQRSASSPGSSRFSRYLHFASGRRNRRQQREQGAPVQEESVQEQSR*
Coding >AgabiH97|046260
ATGGTACTCCTTCTCCTCCTCCTTGCCGCACTCGCCGCCGCCTATATCCCAGCCTCTCCCACAAATTCTACCCAG
GACGCCATTGCTGGTGGACTCAACATCACCGACATATCCAAACTTCGCCTCCAGTGGTATTCAAACGGTAATTAC
GTTGAAAACATCTCTTATCAACTCGCTGGCAATGGTACTAGTGGTATCAGTAAGGGCATTTTGATTCATTTTTCC
GAAGAGTCCGTCAATGAAACGATCCCACCGACGTCTGCACCCTGGATTGCAATGGTCTCTTGCGATGCCAACGCC
ACCGATGCATCAATGGATGTCGATATCTTCACCCTGGCACGCGACAAGGGTGCAGTCGCAGCTTTGTTGTATTCT
CTGCGTTCGCTCGCTTGTGTAATTAATCCAGAATATGCGAACCCGGCAACTTTCGATCAGGTCTTCGATATTTTT
TCGACCCAAAGCAAAACCAGCGCCCGCCTCATTGATTATCAGTTCGGTCAGCTGGCACCGGCGAACAGCAGCATC
ACCAAATATGATTCACAGCGCCTCAATAACACGGCGGAGGCTGTTAGAGACTCCATTCAGGCCGGTCATGCCACG
CGACCTGGGTTTCTGTACGCGGAATTGCGAGCATACAATGCTACCGGAGATACGAACGATCCTGTCGTCACTGGT
TCGAATAGTGGGGACTCGACTGGGAGTGGCACTGGTTCCAAAAATACTGCGCTTGCAATGATAGTTCTCTATGCG
ATCACCGGGTGTGTCTCCGCCCTTTTTTGCATTGTGATCGTTTCAGGAGCCGTTCGTGCACTACGTCATCCTGAA
CGTTACGGACCCCGGGCCAGAATCGGTTTAGATGGTCCACCACAGGGTCGCGCCAGGGGTCTCACTCGTGCCATA
CTTGACACGTTTCCTATTGTCAAGTTTGGAGGGAGCCGTGACAGACCAGTTGATTCCGCCATGGATACGGCAAAT
TCTATTAAGGATATGGAGGCTCAGGACATCAGCCAGTGGGAGCTTCTGGACATTACAGACGCTAAGAGGGAGAGC
ACATTTAAACTCGATGAAGTAAATGCAACTGCGGGATGTACGGCCAGTCAAGCCATTGAAATAGACGATGAGAAG
ACTAGGCTCTCGCGGTCTTCGACGCCAGGCCCTTGTTCTCCACAGATTTTACCTTCTCGAGAAGAGGACCGTGGA
GAAGGATCTTCTACCCCGAAACCGACTTCTTCAAAGCCTCAATTGTCTGACAAACCGGGTATGATGCCCGTACGA
CATGACTTGAGCCCCGAGGCGATGGGGCGCGAGACGTGTCCTATCTGTATCGTCGATTTTGAGAAAGGCGACGAC
ATACGAGTATTGCCCTGTGAAGGCAATCACCGATTTCATCCAGAATGTGTCGACCAATGGTTGCTCCAGTTGTCC
AGTTCTTGCCCTATATGTCGTCAAGATTTCATGGCGCTTGCTGACATGATGTCATATGAAGACGACAGAGAAAGC
CAAGAACTTGGTATTGATGGTTTTGAACCAGATTCACCGGACGAAGACAGGCGCTCATACCATCAATCTCTGAGC
CCACAGCGGTCCGCCTCCTCACCTGGAAGTAGTCGATTCTCGCGGTACCTGCATTTCGCATCTGGCAGACGTAAT
CGACGCCAGCAGAGAGAACAAGGCGCCCCAGTGCAGGAGGAATCAGTGCAAGAACAAAGTCGATAG
Transcript >AgabiH97|046260
ATGGTACTCCTTCTCCTCCTCCTTGCCGCACTCGCCGCCGCCTATATCCCAGCCTCTCCCACAAATTCTACCCAG
GACGCCATTGCTGGTGGACTCAACATCACCGACATATCCAAACTTCGCCTCCAGTGGTATTCAAACGGTAATTAC
GTTGAAAACATCTCTTATCAACTCGCTGGCAATGGTACTAGTGGTATCAGTAAGGGCATTTTGATTCATTTTTCC
GAAGAGTCCGTCAATGAAACGATCCCACCGACGTCTGCACCCTGGATTGCAATGGTCTCTTGCGATGCCAACGCC
ACCGATGCATCAATGGATGTCGATATCTTCACCCTGGCACGCGACAAGGGTGCAGTCGCAGCTTTGTTGTATTCT
CTGCGTTCGCTCGCTTGTGTAATTAATCCAGAATATGCGAACCCGGCAACTTTCGATCAGGTCTTCGATATTTTT
TCGACCCAAAGCAAAACCAGCGCCCGCCTCATTGATTATCAGTTCGGTCAGCTGGCACCGGCGAACAGCAGCATC
ACCAAATATGATTCACAGCGCCTCAATAACACGGCGGAGGCTGTTAGAGACTCCATTCAGGCCGGTCATGCCACG
CGACCTGGGTTTCTGTACGCGGAATTGCGAGCATACAATGCTACCGGAGATACGAACGATCCTGTCGTCACTGGT
TCGAATAGTGGGGACTCGACTGGGAGTGGCACTGGTTCCAAAAATACTGCGCTTGCAATGATAGTTCTCTATGCG
ATCACCGGGTGTGTCTCCGCCCTTTTTTGCATTGTGATCGTTTCAGGAGCCGTTCGTGCACTACGTCATCCTGAA
CGTTACGGACCCCGGGCCAGAATCGGTTTAGATGGTCCACCACAGGGTCGCGCCAGGGGTCTCACTCGTGCCATA
CTTGACACGTTTCCTATTGTCAAGTTTGGAGGGAGCCGTGACAGACCAGTTGATTCCGCCATGGATACGGCAAAT
TCTATTAAGGATATGGAGGCTCAGGACATCAGCCAGTGGGAGCTTCTGGACATTACAGACGCTAAGAGGGAGAGC
ACATTTAAACTCGATGAAGTAAATGCAACTGCGGGATGTACGGCCAGTCAAGCCATTGAAATAGACGATGAGAAG
ACTAGGCTCTCGCGGTCTTCGACGCCAGGCCCTTGTTCTCCACAGATTTTACCTTCTCGAGAAGAGGACCGTGGA
GAAGGATCTTCTACCCCGAAACCGACTTCTTCAAAGCCTCAATTGTCTGACAAACCGGGTATGATGCCCGTACGA
CATGACTTGAGCCCCGAGGCGATGGGGCGCGAGACGTGTCCTATCTGTATCGTCGATTTTGAGAAAGGCGACGAC
ATACGAGTATTGCCCTGTGAAGGCAATCACCGATTTCATCCAGAATGTGTCGACCAATGGTTGCTCCAGTTGTCC
AGTTCTTGCCCTATATGTCGTCAAGATTTCATGGCGCTTGCTGACATGATGTCATATGAAGACGACAGAGAAAGC
CAAGAACTTGGTATTGATGGTTTTGAACCAGATTCACCGGACGAAGACAGGCGCTCATACCATCAATCTCTGAGC
CCACAGCGGTCCGCCTCCTCACCTGGAAGTAGTCGATTCTCGCGGTACCTGCATTTCGCATCTGGCAGACGTAAT
CGACGCCAGCAGAGAGAACAAGGCGCCCCAGTGCAGGAGGAATCAGTGCAAGAACAAAGTCGATAG
Gene >AgabiH97|046260
ATGGTACTCCTTCTCCTCCTCCTTGCCGCACTCGCCGCCGCCTATATCCCAGCCTCTCCCACAAATTCTACCCAG
GACGCCATTGCTGGTGGACTCAACATCACCGACATATCCAAACTTCGCCTCCAGTGGTATTCAAACGGGTCCGTG
CCCACCCCCTTTCTCCAGCAGAGACTTCTCACAGTGTTGCAGTAATTACGTTGAAAACATCTCTTATCAACTCGC
TGGCAATGGTACTAGTGGTATCAGTAAGGTACACCGCGGCTCCCATTTCCTTTGTCTCGCTTCCCTCATTTCCCC
GTCCTTTCAAAGGGCATTTTGATTCATTTTTCCGAAGAGTCCGTCAATGAAACGATCCCACCGAGTGCGCTTTCC
GAAAACCCTCGTAGTGCCAATGTTGATCAGGAGATTTAGCGTCTGCACCCTGGATTGCAATGGTCTCTTGCGATG
CCAACGCCACCGATGCATCAATGGATGTCGATATCTTCACCCTGGCACGCGACAAGGGTGCAGTCGCAGCTGTAT
GTTTATCTCAGCTTAGCCGACATATCTTTTACTCACGACATGTCGTCACCCATTTAGTTGTTGTATTCTCTGCGT
TCGCTCGCTTGTGTAATTAATCCAGAATATGCGAACCCGGCAACTTTCGATCAGGTCTTCGATATTTTTTCGACC
CAAAGCAAAACCAGCGCCCGCCTCATTGATTATCAGTTCGGTCAGCTGGCACCGGCGAACAGCAGCATCACCAAA
TATGATTCACAGCGCCTCAATAACACGGCGGAGGCTGTTAGAGACTCCATTCAGGCCGGTCATGCCACGCGACCT
GGGTTTCTGTACGCGGAATTGCGAGCATACAATGCTACCGGAGATACGAACGATCCTGTCGTCACTGGTTCGAAT
AGTGGGGACTCGACTGGGAGTGGCACTGGTTCCAAAAATACTGCGCTTGCAATGTGAGTTTCAGTCGTCGATGCA
AACCTCAGCCAACTGATGAACTATGGCTTTTTGATCCCTATCAGGATAGTTCTCTATGCGATCACCGGGTGTGTC
TCCGCCCTTTTTTGCATTGTGATCGTTTCAGGAGTACGTTCTGTTTTTCTCCATGCAACCTATCATCATTAACTT
CATTCTCCTTAATGATCAGGCCGTTCGTGCACTACGTCATCCTGAACGTTACGGACCCCGGGCCAGAATCGGTTT
AGATGGTCCACCACAGGGTCGCGCCAGGGGTCTCACTCGTGCCATACTTGACACGTTTCCTATTGTCAAGTTTGG
AGGGAGCCGTGACAGACCAGTTGATTCCGCCATGGATACGGCAAATTCTATTAAGGATATGGAGGCTCAGGACAT
CAGCCAGTGGGAGCTTCTGGACATTACAGACGCTAAGAGGGAGAGCACATTTAAACTCGATGAAGTAAATGCAAC
TGCGGGATGTACGGCCAGTCAAGCCATTGAAATAGACGATGAGAAGACTAGGCTCTCGCGGTCTTCGACGCCAGG
CCCTTGTTCTCCACAGATTTTACCTTCTCGAGAAGAGGACCGTGGAGAAGGATCTTCTACCCCGAAACCGACTTC
TTCAAAGCCTCAATTGTCTGACAAACCGGGTATGATGCCCGTACGACATGACTTGAGCCCCGAGGCGATGGGGCG
CGAGACGTGTCCTATCTGTATCGTCGATTTTGAGAAAGGCGACGACATACGAGTATTGCCCTGTGAAGGCAATCA
CCGATTTCATCCAGAATGTGTCGACCAATGGTTGCTCCAGTTGTCCAGTTCTTGCCCTATATGTCGTCAAGGTGT
GTTAATCAGTTGTAACACATCGTTCTCTTTGCCATCTACTGATGCAATCTTATGACAGATTTCATGGCGCTTGCT
GACATGATGTCATATGAAGACGACAGAGAAAGCCAAGAACTTGGTATTGATGGTTTTGAACCAGATTCACCGGAC
GAAGACAGGCGCTCATACCATCAATCTCTGAGCCCACAGCGGTCCGCCTCCTCACCTGGAAGTAGTCGATTCTCG
CGGTACCTGCATTTCGCATCTGGCAGACGTAATCGACGCCAGCAGAGAGAACAAGGCGCCCCAGTGCAGGAGGAA
TCAGTGCAAGAACAAAGTCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail