Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046080
Gene name
Locationscaffold_2:1865564..1867464
Strand+
Gene length (bp)1900
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 4.9E-14 141 221
PF08544 GHMP_kinases_C GHMP kinases C terminal 4.4E-08 372 433

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UT88|ERG8_SCHPO Probable phosphomevalonate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg8 PE=3 SV=1 3 459 1.0E-62
sp|P24521|ERG8_YEAST Phosphomevalonate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG8 PE=1 SV=2 8 430 2.0E-51

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046080
MPLSTVVSSPGKVLLTGGYLVLDPAYSGTVISASSRFYTIVQDDTTVGSGNIRVRSPQFNDATWNFVVDIDSESI
LDPGSNNATKNKFVQLALEKTIRLAVELKEKTIIQERATLASLSISRTLESLKMIKPFNKSGITLSDVHKTGLGS
SAALITSLVSALLVHFSVLPKSAFSEDAENNHDAKMDVLGKALAHNLAQYVHCLAQGKVGSGFDVSAAVFGTHLY
TRFDPAVLQLLMDDSTHQTLEPVISPSNPSWNHSIKPFKLPPLTRLMLADVDAGSDTPSLVGKVLKWRKENSVES
DTLWREIDQLNQSFAQTLLHISTLHDQDTVNYGTALKYISSLQPVQWAANPWQPEEEIPIVEAFYEAHRISQDIR
EKMRKMGVLAGVPIEPPEQTKLLNACVTQAGVIGGGVPGAGGYDAIWLLVCDPIDCSPDQRPTERVEYVWSNYKD
LDVSPLSTSESTISGSRLEQLEGVPGLKEAVSIE*
Coding >AgabiH97|046080
ATGCCTCTTTCAACCGTTGTCTCTTCCCCAGGCAAGGTCCTCCTCACAGGAGGTTACCTCGTGCTTGACCCAGCC
TACTCTGGCACTGTCATTTCTGCCTCTTCTCGCTTTTATACTATAGTGCAAGATGATACCACAGTCGGCTCAGGT
AACATCCGCGTTCGTTCACCTCAATTCAATGATGCAACCTGGAATTTTGTGGTCGACATCGACTCCGAGAGTATT
CTCGACCCTGGATCCAACAACGCCACAAAAAACAAATTCGTACAACTTGCATTGGAGAAGACGATCAGGTTAGCT
GTTGAGCTGAAGGAAAAAACCATCATTCAAGAGCGCGCGACACTTGCGTCGCTAAGCATCTCAAGGACGCTCGAG
TCTCTGAAAATGATAAAACCCTTCAACAAGTCGGGCATCACACTATCGGATGTACATAAAACCGGCTTGGGGTCT
TCTGCAGCGCTCATAACATCACTTGTTTCCGCGCTTCTTGTTCATTTTTCTGTTCTTCCGAAATCGGCTTTTTCG
GAAGACGCAGAGAACAATCATGATGCGAAGATGGACGTGTTGGGAAAAGCTCTCGCTCACAATCTTGCTCAATAC
GTGCACTGTCTGGCTCAAGGAAAAGTTGGAAGTGGATTCGACGTCTCGGCCGCGGTGTTTGGGACACATCTTTAC
ACGAGGTTCGACCCGGCAGTTCTTCAACTGCTTATGGATGATTCGACGCATCAAACGCTTGAGCCGGTTATATCT
CCGTCCAACCCGTCATGGAATCACAGCATCAAGCCGTTTAAGCTTCCGCCGTTGACCCGATTAATGCTGGCAGAT
GTAGACGCTGGGAGCGATACACCATCACTCGTAGGTAAGGTTCTCAAATGGAGAAAAGAGAACAGCGTTGAGTCC
GACACATTATGGAGAGAGATTGACCAATTGAACCAGTCTTTTGCGCAAACCCTGCTTCATATCTCGACGCTTCAT
GACCAAGATACAGTTAACTATGGTACAGCCTTGAAATATATCTCTTCACTCCAGCCTGTTCAATGGGCTGCAAAC
CCATGGCAACCGGAAGAAGAAATACCTATCGTTGAAGCCTTCTATGAAGCCCACCGCATATCACAGGATATACGA
GAGAAAATGCGAAAGATGGGTGTCCTTGCCGGTGTTCCGATAGAGCCACCTGAGCAGACGAAGCTTCTCAATGCA
TGTGTAACTCAAGCTGGTGTAATCGGAGGTGGTGTGCCAGGAGCTGGAGGCTATGATGCAATCTGGCTACTAGTC
TGTGATCCCATCGATTGTTCTCCAGATCAACGTCCGACAGAGCGGGTTGAATACGTATGGAGTAACTACAAAGAT
TTGGACGTATCTCCTCTCTCGACCTCGGAGAGTACGATCAGCGGCAGCCGGCTGGAACAACTCGAAGGGGTACCG
GGACTGAAAGAAGCGGTCTCAATCGAGTGA
Transcript >AgabiH97|046080
ATGCCTCTTTCAACCGTTGTCTCTTCCCCAGGCAAGGTCCTCCTCACAGGAGGTTACCTCGTGCTTGACCCAGCC
TACTCTGGCACTGTCATTTCTGCCTCTTCTCGCTTTTATACTATAGTGCAAGATGATACCACAGTCGGCTCAGGT
AACATCCGCGTTCGTTCACCTCAATTCAATGATGCAACCTGGAATTTTGTGGTCGACATCGACTCCGAGAGTATT
CTCGACCCTGGATCCAACAACGCCACAAAAAACAAATTCGTACAACTTGCATTGGAGAAGACGATCAGGTTAGCT
GTTGAGCTGAAGGAAAAAACCATCATTCAAGAGCGCGCGACACTTGCGTCGCTAAGCATCTCAAGGACGCTCGAG
TCTCTGAAAATGATAAAACCCTTCAACAAGTCGGGCATCACACTATCGGATGTACATAAAACCGGCTTGGGGTCT
TCTGCAGCGCTCATAACATCACTTGTTTCCGCGCTTCTTGTTCATTTTTCTGTTCTTCCGAAATCGGCTTTTTCG
GAAGACGCAGAGAACAATCATGATGCGAAGATGGACGTGTTGGGAAAAGCTCTCGCTCACAATCTTGCTCAATAC
GTGCACTGTCTGGCTCAAGGAAAAGTTGGAAGTGGATTCGACGTCTCGGCCGCGGTGTTTGGGACACATCTTTAC
ACGAGGTTCGACCCGGCAGTTCTTCAACTGCTTATGGATGATTCGACGCATCAAACGCTTGAGCCGGTTATATCT
CCGTCCAACCCGTCATGGAATCACAGCATCAAGCCGTTTAAGCTTCCGCCGTTGACCCGATTAATGCTGGCAGAT
GTAGACGCTGGGAGCGATACACCATCACTCGTAGGTAAGGTTCTCAAATGGAGAAAAGAGAACAGCGTTGAGTCC
GACACATTATGGAGAGAGATTGACCAATTGAACCAGTCTTTTGCGCAAACCCTGCTTCATATCTCGACGCTTCAT
GACCAAGATACAGTTAACTATGGTACAGCCTTGAAATATATCTCTTCACTCCAGCCTGTTCAATGGGCTGCAAAC
CCATGGCAACCGGAAGAAGAAATACCTATCGTTGAAGCCTTCTATGAAGCCCACCGCATATCACAGGATATACGA
GAGAAAATGCGAAAGATGGGTGTCCTTGCCGGTGTTCCGATAGAGCCACCTGAGCAGACGAAGCTTCTCAATGCA
TGTGTAACTCAAGCTGGTGTAATCGGAGGTGGTGTGCCAGGAGCTGGAGGCTATGATGCAATCTGGCTACTAGTC
TGTGATCCCATCGATTGTTCTCCAGATCAACGTCCGACAGAGCGGGTTGAATACGTATGGAGTAACTACAAAGAT
TTGGACGTATCTCCTCTCTCGACCTCGGAGAGTACGATCAGCGGCAGCCGGCTGGAACAACTCGAAGGGGTACCG
GGACTGAAAGAAGCGGTCTCAATCGAGTGA
Gene >AgabiH97|046080
ATGCCTCTTTCAACCGTTGTCTCTTCCCCAGGCAAGGTCCTCCTCACAGGAGGTTACCTCGTGCTTGACCCAGCC
TACTCTGGCACTGTCATTTCTGCCTCTTCTCGCTTTTATACTATAGTGCAAGATGATACCACAGTCGGCTCAGGT
AACATCCGCGTTCGTTCACCTCAATTCAATGATGCAACCTGGAATTTTGTGGTCGACATCGACTCCGAGAGTATT
CTCGACCCTGGATCCAACAAGTGCGTAACGTTATGATAGATCCGTGGGATGCATCTGGAAGGTTTCTGCAGCGCC
ACAAAAAACAAATTCGTACAACTTGCATTGGAGAAGACGATCAGGTTAGCTGTTGAGCTGAAGGAAAAAACCATC
ATTCAAGAGGTGCTCTCACATGGAATCGATATTGCTATCGTCGGGGACAATGATTTCTATTCCCAGCGCGCGACA
GTAAACAATTCATTCACCATTGTTACATTGCCATCTTTCTGATCGGGGCCTAGCTTGCGTCGCTAAGCATCTCAA
GGACGCTCGAGTCTCTGAAAATGATAAAACCCTTCAACAAGTCGGGCATCACACTATCGGATGTACATAAAACCG
GCTTGGGGTCTTCTGCAGCGCTCATAACATCACTTGTTTCCGCGCTTCTTGTTCATTTTTCTGTTCTTCCGAAAT
CGGCTTTTTCGGAAGACGCAGAGAACAATCATGATGCGAAGATGGACGTGTTGGGAAAAGCTCTCGCTCACAATC
TTGCTCAATACGTGCACTGTCTGGCTCAAGGAAAAGTTGGAAGTGGATTCGACGTCTCGGCCGCGGTGTTTGGGA
CACATCTTTACACGAGGTTCGACCCGGCAGTTCTTCAACTGCTTATGGATGATTCGACGGTGTGTTTCATCTAAT
TATGAAATGAGATGTTTTTACAATTCTCGATCCGCTTTACCAGCATCAAACGCTTGAGCCGGTTATATCTCCGTC
CAACCCGTCATGGAATCACAGCATCAAGCCGTTTAAGCTTCCGCCGTTGACCCGATTAATGCTGGCAGATGTAGA
CGCTGGGAGCGATACACCATCACTCGTAGGTAAGGTTCTCAAATGGAGAAAAGAGAACAGCGTTGAGTGTGAGGC
TTTGGTAGTCACTTTCTTTCTCGAATCTGCACTGACAGTGTTTGCTAGCCGACACATTATGGAGAGAGATTGACC
AATTGAACCAGTCTTTTGCGCAAACCCTGCTTCATATCTCGACGCTTCATGACCAAGATACAGTTAACTATGGTA
CAGCCTTGAAATATATCTCTTCACTCCAGCCTGTTCAAGTGAGTATCTTTTGAGTTCATCCTGGATTACCTCTGA
TAAGATTTTACGTGCACAGTGGGCTGCAAACCCATGGCAACCGGAAGAAGAAATACCTATCGTTGAAGCCTTCTA
TGAAGCCCACCGCATATCACAGGCATGCTCATAATTTCCTCTTATCTCTTCAAGCCCCAATTAAGATTGTTGCTC
AGGATATACGAGAGAAAATGCGAAAGATGGGTGTCCTTGCCGGTGTTCCGATAGAGCCACCTGAGCAGACGAAGC
TTCTCAATGCATGTGTAACTCAAGCTGGTGTAATCGGAGGTGGTGTGCCAGGAGGTGTGCCCTTTTATTATTATC
ACTACCTTCCCAGATTCCTAAATGGTCACCATTATCAGCTGGAGGCTATGATGCAATCTGGCTACTAGTCTGTGA
TCCCATCGATTGTTCTCCAGATCAACGTCCGACAGAGCGGGTTGAATACGTATGGAGTAACTACAAAGATTTGGA
CGTATCTCCTCTCTCGACCTCGGAGAGTACGATCAGCGGCAGCCGGCTGGAACAACTCGAAGGGGTACCGGGACT
GAAAGAAGCGGTCTCAATCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail