Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|046060
Gene name
Locationscaffold_2:1861600..1863586
Strand+
Gene length (bp)1986
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 4.8E-08 529 562
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 4.5E-07 531 561
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.1E-05 530 561
PF13445 zf-RING_UBOX RING-type zinc-finger 2.2E-03 531 550

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 140 162 22
3 217 239 22
4 249 266 17
5 268 290 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|046060
MSTSPSNVLDDESLHSVRSMGDVAQSPLPPSSLLRISNDHPASTSTIPPISSAPVGPRNQMDNQDPQHNWLDSLL
AFFGLGKFGLQSRRSTVALSWNFTWSSAQIVVIITLLVLSGTVFKNPNSAAPHVRTEWESCDRPLGVWACLWIGR
VILSSVLAYWNYVRQLRAIASYIQGNPVMVRRGNRQSTIPRADSRQLRPIRQQGIIVPPPNTSYTRLSVLSSLLT
LSWFLTAHILAYTSFNTCRRTSPHVWWLVFGILCIMYLTVFEVVVIGFIVLVITPIVFVLWNILLICLGRHPIQN
AHIIKPEIDKLPKTLVEKIPLVMYIPPPPEGSDLKSTSQKIITSPHNYPPKAPSKPLSKPRFKFLKPRASKKKHS
CPVSAPRLPADVEKTAANGEALAWSDYWEENEYPFVILEGNRAACAICLLDFEEPKRKSGLEHAFTKSSDKEAVE
EPVVESLDYDTKKSDEAEEPVGDLEGREAIKWSQQKSPSTNPTEPRIHSASQVVVRTSSPGIALEDRETNQQLED
AGEEAQPLRLLNCGHVFHKTCLDPWLIDVSGRCPICQRAVEIPGQKSGRS*
Coding >AgabiH97|046060
ATGTCTACGAGTCCCTCAAATGTCCTAGACGACGAGAGCTTACACAGTGTTAGATCTATGGGTGATGTAGCACAA
TCTCCCCTTCCGCCCAGTAGCTTGCTACGGATATCCAACGACCATCCCGCCAGCACCAGCACCATCCCCCCAATC
TCGTCTGCCCCTGTTGGCCCTCGTAATCAAATGGATAATCAGGACCCACAGCATAATTGGCTAGACTCATTGCTG
GCGTTCTTTGGGTTGGGCAAGTTCGGATTACAGAGCAGGAGGTCAACAGTTGCGCTATCATGGAATTTTACATGG
TCATCTGCTCAAATTGTCGTGATAATAACGTTGCTCGTGCTCTCTGGAACCGTGTTCAAGAATCCGAATTCTGCG
GCGCCACATGTGAGAACTGAATGGGAATCCTGCGATAGACCGCTGGGCGTATGGGCGTGCCTGTGGATCGGGAGA
GTGATATTATCATCCGTATTAGCGTACTGGAACTACGTGAGGCAGCTCAGAGCGATTGCTAGCTACATTCAAGGA
AATCCCGTTATGGTTAGGAGGGGCAATAGGCAATCCACAATACCTCGTGCTGACAGTAGGCAGCTTCGTCCAATT
CGACAACAAGGCATTATCGTTCCGCCACCAAATACATCGTATACTCGGCTTTCAGTTCTTTCGTCGTTACTCACC
CTGAGCTGGTTCCTTACTGCCCATATTCTGGCATACACTTCATTTAACACCTGTAGGCGGACCTCGCCTCATGTA
TGGTGGCTCGTATTTGGAATCCTCTGCATCATGTACCTGACGGTCTTCGAAGTGGTGGTAATAGGCTTCATTGTC
TTGGTCATTACACCAATTGTTTTTGTCCTTTGGAATATTTTACTCATCTGCCTTGGTCGTCATCCGATCCAGAAT
GCTCATATAATTAAGCCGGAGATCGACAAATTGCCCAAGACTCTCGTCGAAAAGATTCCTTTAGTAATGTATATC
CCACCACCTCCAGAAGGCTCAGACCTCAAATCTACTTCTCAAAAAATAATCACTTCTCCCCATAATTACCCTCCC
AAAGCACCATCGAAGCCGCTTAGCAAACCTAGATTCAAATTCCTGAAGCCCAGGGCTTCAAAGAAGAAACACTCT
TGTCCAGTCAGCGCTCCTCGTTTGCCTGCTGACGTAGAAAAAACCGCAGCGAATGGAGAGGCACTGGCATGGAGT
GACTATTGGGAAGAAAATGAATATCCCTTTGTCATTCTCGAAGGTAACAGGGCTGCCTGCGCAATCTGTTTGTTG
GATTTTGAGGAGCCAAAGAGAAAATCTGGATTAGAGCATGCTTTTACGAAGTCATCAGACAAAGAGGCAGTCGAA
GAACCCGTCGTTGAATCGCTTGATTACGACACGAAGAAAAGCGATGAAGCCGAAGAGCCAGTGGGAGATTTAGAA
GGAAGAGAGGCAATCAAATGGTCCCAGCAGAAATCACCAAGTACTAATCCAACGGAGCCACGAATACACAGTGCT
TCTCAAGTGGTAGTTCGAACTTCAAGCCCTGGTATTGCCTTGGAAGATAGGGAAACAAACCAACAACTCGAAGAT
GCCGGAGAAGAGGCGCAGCCGCTGAGACTGTTGAATTGCGGACATGTTTTTCATAAAACATGCCTTGACCCCTGG
CTGATTGACGTGTCTGGGAGATGTCCCATCTGTCAACGCGCAGTAGAAATACCAGGCCAGAAATCCGGGAGGTCC
TGA
Transcript >AgabiH97|046060
ATGTCTACGAGTCCCTCAAATGTCCTAGACGACGAGAGCTTACACAGTGTTAGATCTATGGGTGATGTAGCACAA
TCTCCCCTTCCGCCCAGTAGCTTGCTACGGATATCCAACGACCATCCCGCCAGCACCAGCACCATCCCCCCAATC
TCGTCTGCCCCTGTTGGCCCTCGTAATCAAATGGATAATCAGGACCCACAGCATAATTGGCTAGACTCATTGCTG
GCGTTCTTTGGGTTGGGCAAGTTCGGATTACAGAGCAGGAGGTCAACAGTTGCGCTATCATGGAATTTTACATGG
TCATCTGCTCAAATTGTCGTGATAATAACGTTGCTCGTGCTCTCTGGAACCGTGTTCAAGAATCCGAATTCTGCG
GCGCCACATGTGAGAACTGAATGGGAATCCTGCGATAGACCGCTGGGCGTATGGGCGTGCCTGTGGATCGGGAGA
GTGATATTATCATCCGTATTAGCGTACTGGAACTACGTGAGGCAGCTCAGAGCGATTGCTAGCTACATTCAAGGA
AATCCCGTTATGGTTAGGAGGGGCAATAGGCAATCCACAATACCTCGTGCTGACAGTAGGCAGCTTCGTCCAATT
CGACAACAAGGCATTATCGTTCCGCCACCAAATACATCGTATACTCGGCTTTCAGTTCTTTCGTCGTTACTCACC
CTGAGCTGGTTCCTTACTGCCCATATTCTGGCATACACTTCATTTAACACCTGTAGGCGGACCTCGCCTCATGTA
TGGTGGCTCGTATTTGGAATCCTCTGCATCATGTACCTGACGGTCTTCGAAGTGGTGGTAATAGGCTTCATTGTC
TTGGTCATTACACCAATTGTTTTTGTCCTTTGGAATATTTTACTCATCTGCCTTGGTCGTCATCCGATCCAGAAT
GCTCATATAATTAAGCCGGAGATCGACAAATTGCCCAAGACTCTCGTCGAAAAGATTCCTTTAGTAATGTATATC
CCACCACCTCCAGAAGGCTCAGACCTCAAATCTACTTCTCAAAAAATAATCACTTCTCCCCATAATTACCCTCCC
AAAGCACCATCGAAGCCGCTTAGCAAACCTAGATTCAAATTCCTGAAGCCCAGGGCTTCAAAGAAGAAACACTCT
TGTCCAGTCAGCGCTCCTCGTTTGCCTGCTGACGTAGAAAAAACCGCAGCGAATGGAGAGGCACTGGCATGGAGT
GACTATTGGGAAGAAAATGAATATCCCTTTGTCATTCTCGAAGGTAACAGGGCTGCCTGCGCAATCTGTTTGTTG
GATTTTGAGGAGCCAAAGAGAAAATCTGGATTAGAGCATGCTTTTACGAAGTCATCAGACAAAGAGGCAGTCGAA
GAACCCGTCGTTGAATCGCTTGATTACGACACGAAGAAAAGCGATGAAGCCGAAGAGCCAGTGGGAGATTTAGAA
GGAAGAGAGGCAATCAAATGGTCCCAGCAGAAATCACCAAGTACTAATCCAACGGAGCCACGAATACACAGTGCT
TCTCAAGTGGTAGTTCGAACTTCAAGCCCTGGTATTGCCTTGGAAGATAGGGAAACAAACCAACAACTCGAAGAT
GCCGGAGAAGAGGCGCAGCCGCTGAGACTGTTGAATTGCGGACATGTTTTTCATAAAACATGCCTTGACCCCTGG
CTGATTGACGTGTCTGGGAGATGTCCCATCTGTCAACGCGCAGTAGAAATACCAGGCCAGAAATCCGGGAGGTCC
TGA
Gene >AgabiH97|046060
ATGTCTACGAGTCCCTCAAATGTCCTAGACGACGAGAGCTTACACAGTGTTAGATCTATGGGTGATGTAGCACAA
TCTCCCCTTCCGCCCAGTAGCTTGCTACGGATATCCAACGACCATCCCGCCAGCACCAGCACCATCCCCCCAATC
TCGTCTGCCCCTGTTGGCCCTCGTAATCAAATGGATAATCAGGACCCACAGCATAATTGGCTAGACTCATTGCTG
GCGTTCTTTGGGTTGGGCAAGTTCGGATTACAGAGCAGGAGGTCAACAGTTGCGCTATCATGGAATTTTACATGG
TCATCTGCTCAAGTACGTATCACTCGGTATTGACCATGATCTTCACTGAACTTACGCAGATTGTCGTGATAATAA
CGTTGCTCGTGCTCTCTGGAACCGTGTTCAAGAATCCGAATTCTGCGGCGCCACATGTGAGAACTGAATGGGAAT
CCTGCGATAGACCGCTGGGCGTATGGGCGTGCCTGTGGATCGGGAGAGTGATATTATCATCCGTATTAGCGTACT
GGAACTACGTGAGGCAGCTCAGAGCGTGAGTTTTCCAGCTGCTGATCTCTACCGAATTACTAACTTGATCGTAAA
GGATTGCTAGCTACATTCAAGGAAATCCCGTTATGGTTAGGAGGGGCAATAGGCAATCCACAATACCTCGTGCTG
ACAGTAGGCAGCTTCGTCCAATTCGACAACAAGGCATTATCGTTCCGCCACCAAATACATCGTATACTCGGTGCG
CAACAGGCTGTACTTCCATGAATTCGAAACTGATTTCCTATCAAGGCTTTCAGTTCTTTCGTCGTTACTCACCCT
GAGCTGGTTCCTTACTGCCCATATTCTGGCATACACTTCATTTAACACCTGTAGGCGGACCTCGCCTCATGTATG
GTGGCTCGTATTTGGAATCCTCTGCATCATGTACCTGACGGTCTTCGAAGTGGTGGTAATAGGCTTCATTGTCTT
GGTCATTACACCAATTGTTTTTGTAGGTGATATCGAAACATCTTGCCTACGATTTTTGACAATCTGTTACAGGTC
CTTTGGAATATTTTACTCATCTGCCTTGGTCGTCATCCGATCCAGAATGCTCATATAATTAAGCCGGAGATCGAC
AAATTGCCCAAGACTCTCGTCGAAAAGATTCCTTTAGTAATGTATATCCCACCACCTCCAGAAGGCTCAGACCTC
AAATCTACTTCTCAAAAAATAATCACTTCTCCCCATAATTACCCTCCCAAAGCACCATCGAAGCCGCTTAGCAAA
CCTAGATTCAAATTCCTGAAGCCCAGGGCTTCAAAGAAGAAACACTCTTGTCCAGTCAGCGCTCCTCGTTTGCCT
GCTGACGTAGAAAAAACCGCAGCGAATGGAGAGGCACTGGCATGGAGTGACTATTGGGAAGAAAATGAATATCCC
TTTGTCATTCTCGAAGGTAACAGGGCTGCCTGCGCAATCTGTTTGTTGGATTTTGAGGAGCCAAAGAGAAAATCT
GGATTAGAGCATGCTTTTACGAAGTCATCAGACAAAGAGGCAGTCGAAGAACCCGTCGTTGAATCGCTTGATTAC
GACACGAAGAAAAGCGATGAAGCCGAAGAGCCAGTGGGAGATTTAGAAGGAAGAGAGGCAATCAAATGGTCCCAG
CAGAAATCACCAAGTACTAATCCAACGGAGCCACGAATACACAGTGCTTCTCAAGTGGTAGTTCGAACTTCAAGC
CCTGGTATTGCCTTGGAAGATAGGGAAACAAACCAACAACTCGAAGATGCCGGAGAAGAGGCGCAGCCGCTGAGA
CTGTTGAATTGCGGACATGTTTTTCATGTACGTGTTCCTACGTGTCATCGTATCATCTTCTCTTCTGACTCTGCA
TTATTTCTCCAGAAAACATGCCTTGACCCCTGGCTGATTGACGTGTCTGGGAGATGTCCCATCTGTCAACGCGCA
GTAGAAATACCAGGCCAGAAATCCGGGAGGTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail