© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|046040 |
| Gene name | |
| Location | scaffold_2:1856102..1858803 |
| Strand | - |
| Gene length (bp) | 2701 |
| Transcript length (bp) | 1863 |
| Coding sequence length (bp) | 1863 |
| Protein length (aa) | 621 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 2.1E-20 | 193 | 418 |
| PF03144 | GTP_EFTU_D2 | Elongation factor Tu domain 2 | 3.0E-07 | 452 | 522 |
| PF03143 | GTP_EFTU_D3 | Elongation factor Tu C-terminal domain | 1.7E-06 | 530 | 619 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5R8Q7|GTPB1_PONAB | GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 | 192 | 620 | 1.0E-145 |
| sp|Q58DC5|GTPB1_BOVIN | GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 | 192 | 620 | 2.0E-145 |
| sp|O08582|GTPB1_MOUSE | GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 | 192 | 620 | 2.0E-145 |
| sp|D2XV59|GTPB1_RAT | GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 | 192 | 620 | 2.0E-145 |
| sp|O00178|GTPB1_HUMAN | GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 | 192 | 620 | 4.0E-145 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5R8Q7|GTPB1_PONAB | GTP-binding protein 1 (Fragment) OS=Pongo abelii GN=GTPBP1 PE=2 SV=2 | 192 | 620 | 1.0E-145 |
| sp|Q58DC5|GTPB1_BOVIN | GTP-binding protein 1 OS=Bos taurus GN=GTPBP1 PE=2 SV=2 | 192 | 620 | 2.0E-145 |
| sp|O08582|GTPB1_MOUSE | GTP-binding protein 1 OS=Mus musculus GN=Gtpbp1 PE=1 SV=2 | 192 | 620 | 2.0E-145 |
| sp|D2XV59|GTPB1_RAT | GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp1 PE=1 SV=1 | 192 | 620 | 2.0E-145 |
| sp|O00178|GTPB1_HUMAN | GTP-binding protein 1 OS=Homo sapiens GN=GTPBP1 PE=1 SV=3 | 192 | 620 | 4.0E-145 |
| sp|Q5XGS8|GTPB1_XENLA | GTP-binding protein 1 OS=Xenopus laevis GN=gtpbp1 PE=2 SV=1 | 192 | 620 | 4.0E-137 |
| sp|Q18905|CGP1_CAEEL | GTP-binding protein cgp-1 OS=Caenorhabditis elegans GN=cgp-1 PE=2 SV=2 | 74 | 620 | 2.0E-136 |
| sp|Q17045|AGP1_ASCSU | GTP-binding protein AGP-1 OS=Ascaris suum GN=AGP-1 PE=2 SV=1 | 192 | 619 | 1.0E-129 |
| sp|Q9BX10|GTPB2_HUMAN | GTP-binding protein 2 OS=Homo sapiens GN=GTPBP2 PE=1 SV=1 | 102 | 619 | 4.0E-121 |
| sp|Q3UJK4|GTPB2_MOUSE | GTP-binding protein 2 OS=Mus musculus GN=Gtpbp2 PE=1 SV=1 | 102 | 619 | 1.0E-120 |
| sp|Q5UR72|YR624_MIMIV | Putative GTP-binding protein R624 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R624 PE=3 SV=1 | 194 | 616 | 2.0E-46 |
| sp|P35021|EF1A_SULSO | Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 | 187 | 619 | 9.0E-23 |
| sp|P17196|EF1A_SULAC | Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 | 187 | 619 | 4.0E-22 |
| sp|Q83ES6|EFTU_COXBU | Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 | 191 | 620 | 2.0E-21 |
| sp|A9NAK7|EFTU_COXBR | Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 | 191 | 620 | 2.0E-21 |
| sp|A9KD33|EFTU_COXBN | Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 | 191 | 620 | 2.0E-21 |
| sp|A4YCR6|EF1A_METS5 | Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 | 187 | 619 | 3.0E-21 |
| sp|Q46IW4|EFTU_PROMT | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-21 |
| sp|A2C4U5|EFTU_PROM1 | Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-21 |
| sp|A6Q1L5|EFTU_NITSB | Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 | 288 | 620 | 6.0E-21 |
| sp|Q8R7T8|EFTU2_CALS4 | Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 | 283 | 620 | 7.0E-21 |
| sp|Q8R7V2|EFTU1_CALS4 | Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 | 283 | 620 | 8.0E-21 |
| sp|A9BCK0|EFTU_PROM4 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-20 |
| sp|P42482|EFTU_WOLSU | Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 | 288 | 619 | 3.0E-20 |
| sp|A3DMQ1|EF1A_STAMF | Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 | 191 | 619 | 4.0E-20 |
| sp|P13549|EF1A0_XENLA | Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 | 193 | 588 | 4.0E-20 |
| sp|A2BN41|EF1A_HYPBU | Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 | 288 | 619 | 5.0E-20 |
| sp|Q92005|EF1A_DANRE | Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 | 193 | 588 | 1.0E-19 |
| sp|Q96WZ1|EF1A_COCIM | Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 | 193 | 571 | 1.0E-19 |
| sp|Q318N5|EFTU_PROM9 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-19 |
| sp|Q7UZY7|EFTU_PROMP | Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 | 283 | 620 | 1.0E-19 |
| sp|O21245|EFTU_RECAM | Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 | 288 | 620 | 1.0E-19 |
| sp|A2BYN4|EFTU_PROM5 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-19 |
| sp|B5Z8K3|EFTU_HELPG | Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-19 |
| sp|A2BT83|EFTU_PROMS | Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-19 |
| sp|Q976B1|EF1A_SULTO | Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 | 187 | 619 | 2.0E-19 |
| sp|A8F2E9|EFTU_RICM5 | Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 | 288 | 619 | 2.0E-19 |
| sp|B2UUW8|EFTU_HELPS | Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-19 |
| sp|A8ABM5|EF1A_IGNH4 | Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 | 191 | 619 | 3.0E-19 |
| sp|Q9YIC0|EF1A_ORYLA | Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 | 193 | 588 | 3.0E-19 |
| sp|A1RXW9|EF1A_THEPD | Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 | 191 | 589 | 3.0E-19 |
| sp|A7I3U7|EFTU_CAMHC | Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-19 |
| sp|B6YQ04|EFTU_AZOPC | Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-19 |
| sp|A5ULM5|EF1A_METS3 | Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 | 193 | 571 | 3.0E-19 |
| sp|A7ZCN0|EFTU_CAMC1 | Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-19 |
| sp|Q6L202|EF1A_PICTO | Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 | 188 | 571 | 3.0E-19 |
| sp|P19039|EF1A_APIME | Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 | 193 | 571 | 4.0E-19 |
| sp|A3PEZ7|EFTU_PROM0 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-19 |
| sp|B9K884|EFTU_THENN | Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 | 187 | 620 | 5.0E-19 |
| sp|Q7VA05|EFTU_PROMA | Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-19 |
| sp|A6LLL1|EFTU_THEM4 | Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-19 |
| sp|Q01698|EFTU_THEAQ | Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 | 283 | 620 | 6.0E-19 |
| sp|A9BHA7|EFTU_PETMO | Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 | 288 | 620 | 6.0E-19 |
| sp|B1LBP2|EFTU_THESQ | Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-19 |
| sp|A5IM81|EFTU_THEP1 | Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-19 |
| sp|A7GZK6|EFTU_CAMC5 | Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-19 |
| sp|Q5GWR8|EFTU_XANOR | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 | 191 | 620 | 7.0E-19 |
| sp|Q2NZX1|EFTU_XANOM | Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 | 191 | 620 | 7.0E-19 |
| sp|A8G708|EFTU_PROM2 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-19 |
| sp|P29520|EF1A_BOMMO | Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 | 193 | 600 | 8.0E-19 |
| sp|B7JUP5|EFTU_CYAP8 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 | 191 | 620 | 8.0E-19 |
| sp|P48865|EFTU_RICPR | Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 | 288 | 619 | 8.0E-19 |
| sp|Q92GW4|EFTU_RICCN | Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 | 288 | 619 | 9.0E-19 |
| sp|Q2RFP5|EFTU_MOOTA | Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 | 288 | 620 | 9.0E-19 |
| sp|P13537|EFTU_THEMA | Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 | 288 | 620 | 1.0E-18 |
| sp|A5CCL4|EFTU2_ORITB | Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 | 288 | 620 | 1.0E-18 |
| sp|P05303|EF1A2_DROME | Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 | 193 | 600 | 1.0E-18 |
| sp|Q47LJ1|EFTU_THEFY | Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-18 |
| sp|P43927|SELB_HAEIN | Selenocysteine-specific elongation factor OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=selB PE=3 SV=1 | 274 | 620 | 1.0E-18 |
| sp|Q8KT95|EFTU_RICTY | Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 | 288 | 619 | 1.0E-18 |
| sp|A5GIP0|EFTU_SYNPW | Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-18 |
| sp|P14081|SELB_ECOLI | Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) GN=selB PE=1 SV=3 | 285 | 535 | 1.0E-18 |
| sp|P40911|EF1A_AJECG | Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 | 193 | 571 | 1.0E-18 |
| sp|A8GT71|EFTU_RICRS | Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 | 288 | 619 | 1.0E-18 |
| sp|B0BUR2|EFTU_RICRO | Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 | 288 | 619 | 1.0E-18 |
| sp|C4K2I2|EFTU_RICPU | Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 | 288 | 619 | 1.0E-18 |
| sp|C3PPA9|EFTU_RICAE | Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 | 288 | 619 | 1.0E-18 |
| sp|P56003|EFTU_HELPY | Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-18 |
| sp|Q9Y713|EF1A_ASPOR | Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 | 193 | 588 | 2.0E-18 |
| sp|Q26487|EF1A_SPOFR | Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 | 200 | 586 | 2.0E-18 |
| sp|A5DPE3|EF1A_PICGU | Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 | 193 | 559 | 2.0E-18 |
| sp|Q8KTA3|EFTU_RICRH | Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-18 |
| sp|A5EX84|EFTU_DICNV | Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-18 |
| sp|A5CCA0|EFTU1_ORITB | Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 | 288 | 620 | 2.0E-18 |
| sp|P02994|EF1A_YEAST | Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 | 193 | 588 | 2.0E-18 |
| sp|Q1RHL9|EFTU_RICBR | Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-18 |
| sp|A8GVB2|EFTU_RICB8 | Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-18 |
| sp|B6JN44|EFTU_HELP2 | Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-18 |
| sp|Q59QD6|EF1A2_CANAL | Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 | 193 | 559 | 3.0E-18 |
| sp|A0RQJ3|EFTU_CAMFF | Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-18 |
| sp|C6A4R7|EF1A_THESM | Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 | 191 | 586 | 3.0E-18 |
| sp|Q0AUG3|EFTU2_SYNWW | Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 | 288 | 619 | 3.0E-18 |
| sp|Q9ZK19|EFTU_HELPJ | Elongation factor Tu OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-18 |
| sp|P0A3B0|EFTU_RICSI | Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 | 288 | 619 | 3.0E-18 |
| sp|P0A3A9|EFTU_RICRI | Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 | 288 | 619 | 3.0E-18 |
| sp|A8EZL8|EFTU_RICCK | Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 | 288 | 619 | 4.0E-18 |
| sp|Q605B0|EFTU_METCA | Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 | 283 | 620 | 4.0E-18 |
| sp|P0CY35|EF1A1_CANAL | Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 | 193 | 559 | 4.0E-18 |
| sp|Q90835|EF1A_CHICK | Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 | 193 | 588 | 4.0E-18 |
| sp|P68105|EF1A1_RABIT | Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 | 193 | 588 | 4.0E-18 |
| sp|Q5R4R8|EF1A1_PONAB | Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 | 193 | 588 | 4.0E-18 |
| sp|Q5R1X2|EF1A1_PANTR | Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 | 193 | 588 | 4.0E-18 |
| sp|P68104|EF1A1_HUMAN | Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 | 193 | 588 | 4.0E-18 |
| sp|Q66RN5|EF1A1_FELCA | Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 | 193 | 588 | 4.0E-18 |
| sp|P68103|EF1A1_BOVIN | Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 | 193 | 588 | 4.0E-18 |
| sp|Q5VTE0|EF1A3_HUMAN | Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 | 193 | 588 | 5.0E-18 |
| sp|P62630|EF1A1_RAT | Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 | 193 | 588 | 5.0E-18 |
| sp|P10126|EF1A1_MOUSE | Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 | 193 | 588 | 5.0E-18 |
| sp|P62629|EF1A1_CRIGR | Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 | 193 | 588 | 5.0E-18 |
| sp|P19486|EF1A_THEAC | Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 | 288 | 571 | 5.0E-18 |
| sp|Q8TRC4|EF1A_METAC | Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 | 191 | 572 | 6.0E-18 |
| sp|Q8KT99|EFTU_RICHE | Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 | 288 | 619 | 6.0E-18 |
| sp|Q01765|EF1A_PODCU | Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 | 193 | 571 | 6.0E-18 |
| sp|P02993|EF1A_ARTSA | Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 | 193 | 591 | 8.0E-18 |
| sp|Q3J8Q0|EFTU_NITOC | Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 | 191 | 620 | 9.0E-18 |
| sp|Q01520|EF1A_PODAS | Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 | 193 | 571 | 9.0E-18 |
| sp|Q00251|EF1A_AURPU | Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 | 193 | 571 | 1.0E-17 |
| sp|P41203|EF1A_DESMO | Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 | 191 | 600 | 1.0E-17 |
| sp|B9KFF9|EFTU_CAMLR | Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-17 |
| sp|Q255F3|EFTU_CHLFF | Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-17 |
| sp|C5D3R5|EFTU_GEOSW | Elongation factor Tu OS=Geobacillus sp. (strain WCH70) GN=tuf PE=3 SV=1 | 191 | 620 | 1.0E-17 |
| sp|Q03033|EF1A_WHEAT | Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 | 193 | 600 | 1.0E-17 |
| sp|O64937|EF1A_ORYSJ | Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 | 193 | 600 | 2.0E-17 |
| sp|Q0AUH8|EFTU1_SYNWW | Elongation factor Tu 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf1 PE=3 SV=1 | 288 | 619 | 2.0E-17 |
| sp|Q09069|EF1A_SORMA | Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 | 193 | 571 | 2.0E-17 |
| sp|B7K834|EFTU_CYAP7 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1 | 191 | 620 | 2.0E-17 |
| sp|P29542|EFTU1_STRRA | Elongation factor Tu-1 OS=Streptomyces ramocissimus GN=tuf1 PE=3 SV=1 | 284 | 620 | 2.0E-17 |
| sp|A5GW14|EFTU_SYNR3 | Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-17 |
| sp|B0BBV3|EFTU_CHLTB | Elongation factor Tu OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tuf PE=3 SV=1 | 191 | 620 | 2.0E-17 |
| sp|B0B7N8|EFTU_CHLT2 | Elongation factor Tu OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tuf PE=1 SV=1 | 191 | 620 | 2.0E-17 |
| sp|A1RRJ3|EF1A_PYRIL | Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 | 182 | 571 | 2.0E-17 |
| sp|B7IHU4|EFTU_THEAB | Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-17 |
| sp|A5D5K0|EFTU1_PELTS | Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 | 288 | 619 | 2.0E-17 |
| sp|Q0BUQ2|EFTU_GRABC | Elongation factor Tu OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-17 |
| sp|P43643|EF1A_TOBAC | Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 | 193 | 571 | 3.0E-17 |
| sp|P42472|EFTU_CHLAU | Elongation factor Tu (Fragment) OS=Chloroflexus aurantiacus GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|A9WFP3|EFTU_CHLAA | Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|P84316|EF1A_HELZE | Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84315|EF1A_HELVI | Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84318|EF1A_HELGL | Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84320|EF1A_HELDI | Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84317|EF1A_HELAM | Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84319|EF1A_HELAL | Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84322|EF1A_ANIIF | Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|P84321|EF1A_ADIBE | Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 | 200 | 586 | 3.0E-17 |
| sp|A5D5I8|EFTU2_PELTS | Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 | 288 | 619 | 3.0E-17 |
| sp|A8F982|EFTU_BACP2 | Elongation factor Tu OS=Bacillus pumilus (strain SAFR-032) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|Q5L5H6|EFTU_CHLAB | Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|P43926|EFTU_HAEIN | Elongation factor Tu OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tufA PE=3 SV=2 | 288 | 620 | 3.0E-17 |
| sp|A5UHC1|EFTU_HAEIG | Elongation factor Tu OS=Haemophilus influenzae (strain PittGG) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|A5U9R1|EFTU_HAEIE | Elongation factor Tu OS=Haemophilus influenzae (strain PittEE) GN=tuf1 PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|Q4QMT5|EFTU2_HAEI8 | Elongation factor Tu 2 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf2 PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|A6TEX7|EFTU_KLEP7 | Elongation factor Tu OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tufA PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|Q8TYP6|EF1A_METKA | Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 | 193 | 586 | 3.0E-17 |
| sp|A2Q0Z0|EF1A1_HORSE | Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 | 193 | 588 | 3.0E-17 |
| sp|P17786|EF1A_SOLLC | Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 | 193 | 571 | 3.0E-17 |
| sp|Q822I4|EFTU_CHLCV | Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 | 288 | 620 | 3.0E-17 |
| sp|P14963|EF1A_EUGGR | Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 | 193 | 559 | 3.0E-17 |
| sp|Q042T5|EFTU_LACGA | Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 | 288 | 620 | 3.0E-17 |
| sp|C4K4F8|EFTU_HAMD5 | Elongation factor Tu OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-17 |
| sp|P34825|EF1A_HYPJE | Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 | 193 | 571 | 3.0E-17 |
| sp|P29521|EF1A1_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 | 193 | 571 | 3.0E-17 |
| sp|Q01372|EF1A_NEUCR | Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 | 193 | 571 | 3.0E-17 |
| sp|Q5HVZ7|EFTU_CAMJR | Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|A1VYI6|EFTU_CAMJJ | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|O69303|EFTU_CAMJE | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|A7H4R3|EFTU_CAMJD | Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|A8FKQ5|EFTU_CAMJ8 | Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|B0BQZ3|EFTU_ACTPJ | Elongation factor Tu OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|A3N246|EFTU_ACTP2 | Elongation factor Tu OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|Q8YP63|EFTU_NOSS1 | Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 | 288 | 620 | 4.0E-17 |
| sp|O24534|EF1A_VICFA | Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 | 193 | 600 | 4.0E-17 |
| sp|A0LRL8|EFTU_ACIC1 | Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|Q71V39|EF1A2_RABIT | Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 | 193 | 588 | 4.0E-17 |
| sp|Q05639|EF1A2_HUMAN | Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 | 193 | 588 | 4.0E-17 |
| sp|Q32PH8|EF1A2_BOVIN | Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 | 193 | 588 | 4.0E-17 |
| sp|P0CT55|EF1A3_SCHPO | Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 | 193 | 571 | 4.0E-17 |
| sp|P0CT54|EF1A2_SCHPO | Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 | 193 | 571 | 4.0E-17 |
| sp|Q7VJ74|EFTU_HELHP | Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|P08736|EF1A1_DROME | Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 | 193 | 571 | 4.0E-17 |
| sp|Q7M7F1|EFTU_CHRVO | Elongation factor Tu OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-17 |
| sp|Q3AMT6|EFTU_SYNSC | Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-17 |
| sp|Q74JU6|EFTU_LACJO | Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-17 |
| sp|Q839G8|EFTU_ENTFA | Elongation factor Tu OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-17 |
| sp|Q3A9R3|EFTU1_CARHZ | Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 | 288 | 619 | 6.0E-17 |
| sp|P51554|EF1A_HYDVU | Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 | 189 | 571 | 6.0E-17 |
| sp|P62632|EF1A2_RAT | Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 | 193 | 588 | 6.0E-17 |
| sp|P62631|EF1A2_MOUSE | Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 | 193 | 588 | 6.0E-17 |
| sp|P14865|EF1A3_MUCCL | Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 | 193 | 588 | 6.0E-17 |
| sp|P60339|EFTU2_THET8 | Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 | 283 | 620 | 6.0E-17 |
| sp|Q3A9P8|EFTU2_CARHZ | Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 | 288 | 619 | 6.0E-17 |
| sp|A7MKI5|EFTU_CROS8 | Elongation factor Tu OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tuf1 PE=3 SV=1 | 288 | 620 | 6.0E-17 |
| sp|P60338|EFTU1_THETH | Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 | 283 | 620 | 6.0E-17 |
| sp|Q5SHN6|EFTU1_THET8 | Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 | 283 | 620 | 6.0E-17 |
| sp|P0CD71|EFTU_CHLTR | Elongation factor Tu OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tuf PE=3 SV=1 | 191 | 620 | 6.0E-17 |
| sp|Q3KM40|EFTU_CHLTA | Elongation factor Tu OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tuf PE=3 SV=1 | 191 | 620 | 6.0E-17 |
| sp|Q979T1|EF1A_THEVO | Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 | 188 | 571 | 7.0E-17 |
| sp|Q9TJQ8|EFTU_PROWI | Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 | 191 | 620 | 7.0E-17 |
| sp|Q0I0B9|EFTU1_SHESR | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-7) GN=tuf1 PE=3 SV=1 | 288 | 620 | 7.0E-17 |
| sp|Q0HNV1|EFTU1_SHESM | Elongation factor Tu 1 OS=Shewanella sp. (strain MR-4) GN=tuf1 PE=3 SV=1 | 288 | 620 | 7.0E-17 |
| sp|O49169|EF1A_MANES | Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 | 193 | 571 | 7.0E-17 |
| sp|Q72GW4|EFTU_THET2 | Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 | 283 | 620 | 7.0E-17 |
| sp|P27634|EF1A_RHYAM | Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 | 283 | 586 | 7.0E-17 |
| sp|O93729|EF1A_PYRAE | Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 | 182 | 571 | 7.0E-17 |
| sp|Q250N4|EFTU_DESHY | Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 | 283 | 620 | 7.0E-17 |
| sp|B8G1W4|EFTU_DESHD | Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 | 283 | 620 | 7.0E-17 |
| sp|P0CT53|EF1A1_SCHPO | Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 | 193 | 571 | 7.0E-17 |
| sp|Q3MDM5|EFTU_ANAVT | Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-17 |
| sp|P34823|EF1A2_DAUCA | Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 | 193 | 571 | 7.0E-17 |
| sp|A3DJ00|EFTU_CLOTH | Elongation factor Tu OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-17 |
| sp|P34824|EF1A1_HORVU | Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 | 193 | 571 | 8.0E-17 |
| sp|Q2JMX7|EFTU_SYNJB | Elongation factor Tu OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=tuf PE=3 SV=1 | 283 | 620 | 8.0E-17 |
| sp|Q9YAV0|EF1A_AERPE | Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 | 286 | 619 | 8.0E-17 |
| sp|A1SNN5|EFTU_NOCSJ | Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 | 288 | 619 | 9.0E-17 |
| sp|Q6MDN0|EFTU_PARUW | Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 | 191 | 620 | 9.0E-17 |
| sp|B7GJ65|EFTU_ANOFW | Elongation factor Tu OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tuf PE=3 SV=1 | 191 | 620 | 9.0E-17 |
| sp|A4XI37|EFTU_CALS8 | Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 | 284 | 620 | 1.0E-16 |
| sp|P41752|EF1A_ASHGO | Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 | 193 | 588 | 1.0E-16 |
| sp|Q5L3Z9|EFTU_GEOKA | Elongation factor Tu OS=Geobacillus kaustophilus (strain HTA426) GN=tuf PE=3 SV=1 | 284 | 620 | 1.0E-16 |
| sp|O50306|EFTU_GEOSE | Elongation factor Tu OS=Geobacillus stearothermophilus GN=tuf PE=3 SV=2 | 191 | 620 | 1.0E-16 |
| sp|A3MV69|EF1A_PYRCJ | Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 | 182 | 571 | 1.0E-16 |
| sp|Q65QG6|EFTU_MANSM | Elongation factor Tu OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tuf1 PE=3 SV=1 | 288 | 620 | 1.0E-16 |
| sp|Q118Z2|EFTU_TRIEI | Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1 | 191 | 620 | 1.0E-16 |
| sp|P57939|EFTU1_PASMU | Elongation factor Tu-A OS=Pasteurella multocida (strain Pm70) GN=tufA PE=3 SV=1 | 288 | 620 | 1.0E-16 |
| sp|A1AX82|EFTU2_RUTMC | Elongation factor Tu 2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf2 PE=3 SV=1 | 284 | 619 | 1.0E-16 |
| sp|B9MQH1|EFTU_CALBD | Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | 284 | 620 | 1.0E-16 |
| sp|O59153|EF1A_PYRHO | Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 | 191 | 586 | 1.0E-16 |
| sp|P0CT32|EF1A2_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 | 193 | 588 | 1.0E-16 |
| sp|P0CT31|EF1A1_DICDI | Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 | 193 | 588 | 1.0E-16 |
| sp|P09591|EFTU_PSEAE | Elongation factor Tu OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tufA PE=1 SV=2 | 191 | 620 | 1.0E-16 |
| sp|Q02T82|EFTU_PSEAB | Elongation factor Tu OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tuf1 PE=1 SV=1 | 191 | 620 | 1.0E-16 |
| sp|A6UZH4|EFTU_PSEA7 | Elongation factor Tu OS=Pseudomonas aeruginosa (strain PA7) GN=tuf1 PE=3 SV=2 | 191 | 620 | 1.0E-16 |
| sp|P25698|EF1A_SOYBN | Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 | 193 | 571 | 1.0E-16 |
| sp|Q7TTF9|EFTU_HAEDU | Elongation factor Tu OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tufA PE=3 SV=3 | 288 | 620 | 1.0E-16 |
| sp|Q1MPT8|EFTU_LAWIP | Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-16 |
| sp|Q8KT97|EFTU_RICFE | Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 | 288 | 619 | 1.0E-16 |
| sp|Q123F6|EFTU_POLSJ | Elongation factor Tu OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tuf1 PE=3 SV=1 | 191 | 620 | 1.0E-16 |
| sp|Q8KTA1|EFTU_RICMO | Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-16 |
| sp|A1VIP8|EFTU_POLNA | Elongation factor Tu OS=Polaromonas naphthalenivorans (strain CJ2) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-16 |
| sp|P50064|EFTU_GLOVI | Elongation factor Tu OS=Gloeobacter violaceus (strain PCC 7421) GN=tufA PE=3 SV=2 | 191 | 620 | 2.0E-16 |
| sp|Q8KTA6|EFTU_RICPA | Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-16 |
| sp|Q9PK73|EFTU_CHLMU | Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 | 191 | 620 | 2.0E-16 |
| sp|A0RUM4|EF1A_CENSY | Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 | 191 | 571 | 2.0E-16 |
| sp|Q4QMW6|EFTU1_HAEI8 | Elongation factor Tu 1 OS=Haemophilus influenzae (strain 86-028NP) GN=tuf1 PE=3 SV=1 | 288 | 620 | 2.0E-16 |
| sp|B8I5N8|EFTU_CLOCE | Elongation factor Tu OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=tuf PE=3 SV=1 | 191 | 620 | 2.0E-16 |
| sp|A8GPF2|EFTU_RICAH | Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-16 |
| sp|Q7U4D1|EFTU_SYNPX | Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-16 |
| sp|Q4FLK5|EFTU_PELUB | Elongation factor Tu OS=Pelagibacter ubique (strain HTCC1062) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-16 |
| sp|P42477|EFTU_HERAU | Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 | 191 | 620 | 2.0E-16 |
| sp|P14864|EF1A2_MUCCL | Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 | 193 | 571 | 2.0E-16 |
| sp|P06805|EF1A1_MUCCL | Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 | 193 | 571 | 2.0E-16 |
| sp|Q0K5Z9|EFTU_CUPNH | Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-16 |
| sp|A0KRL0|EFTU_SHESA | Elongation factor Tu OS=Shewanella sp. (strain ANA-3) GN=tuf1 PE=3 SV=1 | 288 | 620 | 2.0E-16 |
| sp|Q33451|EFTU_EIMTE | Elongation factor Tu, apicoplast OS=Eimeria tenella GN=tufA PE=3 SV=1 | 290 | 620 | 2.0E-16 |
| sp|Q8GTY0|EF1A4_ARATH | Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 | 193 | 571 | 2.0E-16 |
| sp|Q0WL56|EF1A3_ARATH | Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 | 193 | 571 | 2.0E-16 |
| sp|Q8W4H7|EF1A2_ARATH | Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 | 193 | 571 | 2.0E-16 |
| sp|P0DH99|EF1A1_ARATH | Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 | 193 | 571 | 2.0E-16 |
| sp|P32186|EF1A_PUCGR | Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 | 193 | 559 | 3.0E-16 |
| sp|B0JSE0|EFTU_MICAN | Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 | 283 | 620 | 3.0E-16 |
| sp|C5C0J3|EFTU_BEUC1 | Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-16 |
| sp|Q1LI13|EFTU_CUPMC | Elongation factor Tu OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tuf1 PE=3 SV=1 | 283 | 620 | 3.0E-16 |
| sp|Q00080|EF1A_PLAFK | Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 | 193 | 589 | 3.0E-16 |
| sp|B0SSH9|EFTU_LEPBP | Elongation factor Tu OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-16 |
| sp|B0SAF6|EFTU_LEPBA | Elongation factor Tu OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-16 |
| sp|Q6A6L7|EFTU_PROAC | Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-16 |
| sp|B8GIQ3|EF1A_METPE | Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 | 191 | 571 | 3.0E-16 |
| sp|P28295|EF1A_ABSGL | Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 | 193 | 571 | 3.0E-16 |
| sp|B3ETZ7|EFTU_AMOA5 | Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A4FPM7|EFTU_SACEN | Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 | 288 | 619 | 4.0E-16 |
| sp|Q5QWA3|EFTU_IDILO | Elongation factor Tu OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tuf1 PE=3 SV=1 | 191 | 620 | 4.0E-16 |
| sp|Q83JC4|EFTU_SHIFL | Elongation factor Tu OS=Shigella flexneri GN=tufA PE=3 SV=3 | 288 | 620 | 4.0E-16 |
| sp|Q32B27|EFTU_SHIDS | Elongation factor Tu OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q31VV0|EFTU_SHIBS | Elongation factor Tu OS=Shigella boydii serotype 4 (strain Sb227) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q3YWT3|EFTU1_SHISS | Elongation factor Tu 1 OS=Shigella sonnei (strain Ss046) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q1R5Y2|EFTU1_ECOUT | Elongation factor Tu 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=tuf1 PE=1 SV=1 | 288 | 620 | 4.0E-16 |
| sp|P0CE47|EFTU1_ECOLI | Elongation factor Tu 1 OS=Escherichia coli (strain K12) GN=tufA PE=1 SV=1 | 288 | 620 | 4.0E-16 |
| sp|B1IPW0|EFTU1_ECOLC | Elongation factor Tu 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q0TCC0|EFTU1_ECOL5 | Elongation factor Tu 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A1AGM6|EFTU1_ECOK1 | Elongation factor Tu 1 OS=Escherichia coli O1:K1 / APEC GN=tuf1 PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|A8A5E6|EFTU1_ECOHS | Elongation factor Tu 1 OS=Escherichia coli O9:H4 (strain HS) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A7ZSL4|EFTU1_ECO24 | Elongation factor Tu 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|P0A6N2|EFTU_ECOL6 | Elongation factor Tu OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tufA PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|P0A6N3|EFTU_ECO57 | Elongation factor Tu OS=Escherichia coli O157:H7 GN=tufA PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|Q3YV04|EFTU2_SHISS | Elongation factor Tu 2 OS=Shigella sonnei (strain Ss046) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q0SY20|EFTU2_SHIF8 | Elongation factor Tu 2 OS=Shigella flexneri serotype 5b (strain 8401) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q1R5U4|EFTU2_ECOUT | Elongation factor Tu 2 OS=Escherichia coli (strain UTI89 / UPEC) GN=tuf2 PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|P0CE48|EFTU2_ECOLI | Elongation factor Tu 2 OS=Escherichia coli (strain K12) GN=tufB PE=1 SV=1 | 288 | 620 | 4.0E-16 |
| sp|B1IVA7|EFTU2_ECOLC | Elongation factor Tu 2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q0TA85|EFTU2_ECOL5 | Elongation factor Tu 2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A1AIF3|EFTU2_ECOK1 | Elongation factor Tu 2 OS=Escherichia coli O1:K1 / APEC GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A8A779|EFTU2_ECOHS | Elongation factor Tu 2 OS=Escherichia coli O9:H4 (strain HS) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q2SU25|EFTU_BURTA | Elongation factor Tu OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q63PZ6|EFTU_BURPS | Elongation factor Tu OS=Burkholderia pseudomallei (strain K96243) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A3NEI1|EFTU_BURP6 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 668) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q3JMP6|EFTU_BURP1 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 1710b) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A3P0B5|EFTU_BURP0 | Elongation factor Tu OS=Burkholderia pseudomallei (strain 1106a) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A1V8A5|EFTU_BURMS | Elongation factor Tu OS=Burkholderia mallei (strain SAVP1) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q62GK3|EFTU_BURMA | Elongation factor Tu OS=Burkholderia mallei (strain ATCC 23344) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A2S7F9|EFTU_BURM9 | Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10229) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A3MRT8|EFTU_BURM7 | Elongation factor Tu OS=Burkholderia mallei (strain NCTC 10247) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q6AP86|EFTU1_DESPS | Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 | 191 | 620 | 4.0E-16 |
| sp|Q5WZL4|EFTU_LEGPL | Elongation factor Tu OS=Legionella pneumophila (strain Lens) GN=tuf1 PE=3 SV=1 | 283 | 620 | 4.0E-16 |
| sp|Q1AU14|EFTU_RUBXD | Elongation factor Tu OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A4QBH0|EFTU_CORGB | Elongation factor Tu OS=Corynebacterium glutamicum (strain R) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|P42439|EFTU_CORGL | Elongation factor Tu OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q0SZX8|EFTU1_SHIF8 | Elongation factor Tu 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|P72231|EFTU_PLARO | Elongation factor Tu OS=Planobispora rosea GN=tuf PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|P0A1H5|EFTU_SALTY | Elongation factor Tu OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tufA PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|P0A1H6|EFTU_SALTI | Elongation factor Tu OS=Salmonella typhi GN=tufA PE=3 SV=2 | 288 | 620 | 4.0E-16 |
| sp|A9MT05|EFTU_SALPB | Elongation factor Tu OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q5PIW4|EFTU_SALPA | Elongation factor Tu OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q57H76|EFTU_SALCH | Elongation factor Tu OS=Salmonella choleraesuis (strain SC-B67) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|A9MHG0|EFTU_SALAR | Elongation factor Tu OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q8XGZ0|EFTU_RALSO | Elongation factor Tu OS=Ralstonia solanacearum (strain GMI1000) GN=tufA PE=3 SV=1 | 283 | 620 | 4.0E-16 |
| sp|A7ZUJ2|EFTU2_ECO24 | Elongation factor Tu 2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-16 |
| sp|Q02WY9|EFTU_LACLS | Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 | 288 | 619 | 4.0E-16 |
| sp|A2RMT1|EFTU_LACLM | Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 | 288 | 619 | 4.0E-16 |
| sp|Q9CEI0|EFTU_LACLA | Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 | 288 | 619 | 4.0E-16 |
| sp|Q2S1P8|EFTU_SALRD | Elongation factor Tu OS=Salinibacter ruber (strain DSM 13855 / M31) GN=tuf1 PE=3 SV=1 | 288 | 620 | 5.0E-16 |
| sp|C5BQ44|EFTU_TERTT | Elongation factor Tu OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tuf PE=3 SV=1 | 191 | 620 | 5.0E-16 |
| sp|A5FZW7|EFTU_ACICJ | Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1 | 288 | 619 | 5.0E-16 |
| sp|Q9XD38|EFTU_LEPIN | Elongation factor Tu OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=tuf PE=3 SV=1 | 283 | 619 | 5.0E-16 |
| sp|Q72NF9|EFTU_LEPIC | Elongation factor Tu OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=tuf PE=3 SV=1 | 283 | 619 | 5.0E-16 |
| sp|Q41011|EF1A_PEA | Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 | 288 | 600 | 5.0E-16 |
| sp|A9KRZ4|EFTU_CLOPH | Elongation factor Tu OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tuf PE=3 SV=1 | 191 | 620 | 5.0E-16 |
| sp|Q04634|EF1A_TETPY | Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 | 193 | 615 | 5.0E-16 |
| sp|P17508|EF1A3_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 | 193 | 588 | 5.0E-16 |
| sp|Q9V0V7|EF1A_PYRAB | Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 | 191 | 586 | 5.0E-16 |
| sp|Q5ZYP5|EFTU_LEGPH | Elongation factor Tu OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tuf1 PE=3 SV=1 | 283 | 620 | 5.0E-16 |
| sp|A5IHR6|EFTU_LEGPC | Elongation factor Tu OS=Legionella pneumophila (strain Corby) GN=tuf1 PE=3 SV=1 | 283 | 620 | 5.0E-16 |
| sp|Q5X873|EFTU_LEGPA | Elongation factor Tu OS=Legionella pneumophila (strain Paris) GN=tuf1 PE=3 SV=1 | 283 | 620 | 5.0E-16 |
| sp|Q46WC7|EFTU_CUPPJ | Elongation factor Tu OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tuf1 PE=3 SV=1 | 283 | 620 | 5.0E-16 |
| sp|P40174|EFTU1_STRCO | Elongation factor Tu-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf1 PE=3 SV=1 | 284 | 619 | 6.0E-16 |
| sp|Q40034|EF1A2_HORVU | Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 | 193 | 571 | 6.0E-16 |
| sp|Q9TLV8|EFTU_CYACA | Elongation factor Tu, chloroplastic OS=Cyanidium caldarium GN=tufA PE=3 SV=1 | 290 | 620 | 6.0E-16 |
| sp|Q8FS84|EFTU_COREF | Elongation factor Tu OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=tuf PE=3 SV=1 | 288 | 620 | 6.0E-16 |
| sp|A7I656|EF1A_METB6 | Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 | 191 | 589 | 6.0E-16 |
| sp|Q46455|SELB_MOOTH | Selenocysteine-specific elongation factor OS=Moorella thermoacetica GN=selB PE=1 SV=1 | 273 | 588 | 6.0E-16 |
| sp|C3PKP2|EFTU_CORA7 | Elongation factor Tu OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=tuf PE=3 SV=1 | 288 | 620 | 6.0E-16 |
| sp|O29325|EF1A_ARCFU | Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 | 287 | 589 | 6.0E-16 |
| sp|Q3BWY6|EFTU_XANC5 | Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 | 191 | 620 | 6.0E-16 |
| sp|Q8NL22|EFTU_XANAC | Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 | 191 | 620 | 6.0E-16 |
| sp|A8LC58|EFTU_FRASN | Elongation factor Tu OS=Frankia sp. (strain EAN1pec) GN=tuf PE=3 SV=1 | 284 | 620 | 7.0E-16 |
| sp|B3WE38|EFTU_LACCB | Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 | 191 | 620 | 7.0E-16 |
| sp|Q039K9|EFTU_LACC3 | Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 | 191 | 620 | 7.0E-16 |
| sp|A4IJI7|EFTU_GEOTN | Elongation factor Tu OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tuf PE=3 SV=1 | 191 | 620 | 7.0E-16 |
| sp|B2RL52|EFTU_PORG3 | Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 | 283 | 620 | 7.0E-16 |
| sp|Q9ZT91|EFTM_ARATH | Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 | 191 | 620 | 7.0E-16 |
| sp|A1AVJ8|EFTU1_RUTMC | Elongation factor Tu 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tuf1 PE=3 SV=1 | 191 | 619 | 8.0E-16 |
| sp|A4WKK8|EF1A_PYRAR | Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 | 182 | 571 | 8.0E-16 |
| sp|Q12SW1|EFTU_SHEDO | Elongation factor Tu OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tuf PE=3 SV=1 | 288 | 620 | 8.0E-16 |
| sp|P86939|EF1A2_TRYB2 | Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 | 197 | 606 | 8.0E-16 |
| sp|P86934|EF1A1_TRYB2 | Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 | 197 | 606 | 8.0E-16 |
| sp|Q53871|EFTU1_STRCU | Elongation factor Tu-1 OS=Streptomyces collinus GN=tuf1 PE=3 SV=1 | 288 | 619 | 8.0E-16 |
| sp|Q8DI42|EFTU_THEEB | Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1 | 191 | 620 | 9.0E-16 |
| sp|Q41803|EF1A_MAIZE | Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 | 193 | 600 | 9.0E-16 |
| sp|P33166|EFTU_BACSU | Elongation factor Tu OS=Bacillus subtilis (strain 168) GN=tuf PE=3 SV=1 | 288 | 619 | 9.0E-16 |
| sp|B2J5B1|EFTU_NOSP7 | Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|P41745|EF1A_BLAAD | Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 | 193 | 571 | 1.0E-15 |
| sp|P59506|EFTU_BUCBP | Elongation factor Tu OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|P50256|EF1AC_PORPU | Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 | 193 | 588 | 1.0E-15 |
| sp|Q2JFH8|EFTU_FRASC | Elongation factor Tu OS=Frankia sp. (strain CcI3) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|B3QY22|EFTU_CHLT3 | Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|A8MAJ1|EF1A_CALMQ | Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 | 191 | 571 | 1.0E-15 |
| sp|Q0RRS3|EFTU_FRAAA | Elongation factor Tu OS=Frankia alni (strain ACN14a) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|A7HM54|EFTU_FERNB | Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|B4RYQ8|EFTU_ALTMD | Elongation factor Tu OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tuf1 PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|A4W5A0|EFTU_ENT38 | Elongation factor Tu OS=Enterobacter sp. (strain 638) GN=tuf1 PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|A2STF0|EF1A_METLZ | Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 | 191 | 572 | 1.0E-15 |
| sp|P57966|EFTU2_PASMU | Elongation factor Tu-B OS=Pasteurella multocida (strain Pm70) GN=tufB PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|A6LPP6|EFTU_CLOB8 | Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|B0UV21|EFTU_HISS2 | Elongation factor Tu OS=Histophilus somni (strain 2336) GN=tuf PE=3 SV=1 | 283 | 620 | 1.0E-15 |
| sp|Q0I1U9|EFTU_HAES1 | Elongation factor Tu OS=Haemophilus somnus (strain 129Pt) GN=tuf1 PE=3 SV=1 | 283 | 620 | 1.0E-15 |
| sp|A2CC87|EFTU_PROM3 | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|A4SUU7|EFTU_POLSQ | Elongation factor Tu OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tuf1 PE=3 SV=1 | 283 | 620 | 1.0E-15 |
| sp|Q7V500|EFTU_PROMM | Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-15 |
| sp|Q21SF0|EFTU1_RHOFT | Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 | 283 | 620 | 1.0E-15 |
| sp|P42474|EFTU_CELLY | Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|A1B002|EFTU_PARDP | Elongation factor Tu OS=Paracoccus denitrificans (strain Pd 1222) GN=tuf1 PE=3 SV=1 | 288 | 620 | 2.0E-15 |
| sp|Q82DQ0|EFTU1_STRAW | Elongation factor Tu 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf1 PE=3 SV=1 | 288 | 619 | 2.0E-15 |
| sp|P09953|EFTU_MICLU | Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-15 |
| sp|A6W5T5|EFTU_KINRD | Elongation factor Tu OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tuf PE=3 SV=1 | 191 | 620 | 2.0E-15 |
| sp|Q30X13|EFTU_DESAG | Elongation factor Tu OS=Desulfovibrio alaskensis (strain G20) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-15 |
| sp|B0RU96|EFTU2_XANCB | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=tuf2 PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|Q4URC5|EFTU2_XANC8 | Elongation factor Tu 2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf2 PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|Q8PC59|EFTU1_XANCP | Elongation factor Tu-A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufA PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|B0TC54|EFTU_HELMI | Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-15 |
| sp|Q13TF5|EFTU_BURXL | Elongation factor Tu OS=Burkholderia xenovorans (strain LB400) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|P17507|EF1A2_XENLA | Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 | 193 | 588 | 2.0E-15 |
| sp|A5CW32|EFTU_VESOH | Elongation factor Tu OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tuf1 PE=3 SV=1 | 288 | 619 | 2.0E-15 |
| sp|O42820|EF1A_SCHCO | Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 | 193 | 571 | 2.0E-15 |
| sp|Q21RV6|EFTU2_RHOFT | Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|Q8PC51|EFTU2_XANCP | Elongation factor Tu-B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tufB PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|Q4URD7|EFTU1_XANC8 | Elongation factor Tu 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-15 |
| sp|Q73H85|EFTU2_WOLPM | Elongation factor Tu 2 OS=Wolbachia pipientis wMel GN=tuf2 PE=3 SV=1 | 288 | 620 | 2.0E-15 |
| sp|P02991|EFTU_EUGGR | Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1 | 191 | 620 | 2.0E-15 |
| sp|Q2HJN8|EF1A2_OSCTI | Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 | 193 | 588 | 2.0E-15 |
| sp|Q4L3K9|EFTU_STAHJ | Elongation factor Tu OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-15 |
| sp|Q49V58|EFTU_STAS1 | Elongation factor Tu OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tuf PE=3 SV=1 | 288 | 619 | 2.0E-15 |
| sp|Q73IX6|EFTU1_WOLPM | Elongation factor Tu 1 OS=Wolbachia pipientis wMel GN=tuf1 PE=3 SV=1 | 288 | 620 | 2.0E-15 |
| sp|A9H3R7|EFTU_GLUDA | Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 | 283 | 619 | 2.0E-15 |
| sp|Q8D240|EFTU_WIGBR | Elongation factor Tu OS=Wigglesworthia glossinidia brevipalpis GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|A1T4L6|EFTU_MYCVP | Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q01SX2|EFTU_SOLUE | Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 | 283 | 620 | 3.0E-15 |
| sp|Q54HB2|EFTU_DICDI | Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 | 191 | 620 | 3.0E-15 |
| sp|Q3YRK7|EFTU_EHRCJ | Elongation factor Tu OS=Ehrlichia canis (strain Jake) GN=tuf1 PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q15NP2|EFTU_PSEA6 | Elongation factor Tu OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tuf1 PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q3SLQ1|EFTU_THIDA | Elongation factor Tu OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tuf1 PE=3 SV=1 | 283 | 619 | 3.0E-15 |
| sp|C0ZVT7|EFTU_RHOE4 | Elongation factor Tu OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q5F5Q8|EFTU_NEIG1 | Elongation factor Tu OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tuf1 PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q8CQ81|EFTU_STAES | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q5HRK4|EFTU_STAEQ | Elongation factor Tu OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|P42480|EFTU_HYMOC | Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 | 283 | 620 | 3.0E-15 |
| sp|Q8EX18|EFTU_MYCPE | Elongation factor Tu OS=Mycoplasma penetrans (strain HF-2) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|B5ZC31|EFTU_UREU1 | Elongation factor Tu OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=tuf PE=3 SV=1 | 288 | 618 | 3.0E-15 |
| sp|C5CGR6|EFTU_KOSOT | Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|A1T056|EFTU_PSYIN | Elongation factor Tu OS=Psychromonas ingrahamii (strain 37) GN=tuf PE=3 SV=1 | 288 | 620 | 3.0E-15 |
| sp|Q7MYE8|EFTU2_PHOLL | Elongation factor Tu 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-15 |
| sp|Q1LSY4|EFTU_BAUCH | Elongation factor Tu OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-15 |
| sp|Q7N9B1|EFTU1_PHOLL | Elongation factor Tu 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-15 |
| sp|Q2JUX4|EFTU_SYNJA | Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 | 288 | 620 | 4.0E-15 |
| sp|Q8EK81|EFTU1_SHEON | Elongation factor Tu 1 OS=Shewanella oneidensis (strain MR-1) GN=tuf1 PE=3 SV=1 | 288 | 620 | 4.0E-15 |
| sp|Q1ACI3|EFTU_CHAVU | Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 | 283 | 620 | 4.0E-15 |
| sp|Q0I0A7|EFTU2_SHESR | Elongation factor Tu 2 OS=Shewanella sp. (strain MR-7) GN=tuf2 PE=3 SV=1 | 288 | 620 | 4.0E-15 |
| sp|Q5JFZ4|EF1A_THEKO | Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 | 191 | 586 | 4.0E-15 |
| sp|Q8U152|EF1A_PYRFU | Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 | 191 | 586 | 4.0E-15 |
| sp|Q9Z9A7|EFTU_CHLPN | Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 | 191 | 619 | 4.0E-15 |
| sp|P48864|EFTU_NEIGO | Elongation factor Tu OS=Neisseria gonorrhoeae GN=tuf PE=3 SV=1 | 288 | 620 | 5.0E-15 |
| sp|O59949|EF1A_YARLI | Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 | 193 | 559 | 5.0E-15 |
| sp|A1JIH3|EFTU1_YERE8 | Elongation factor Tu 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tuf1 PE=3 SV=1 | 288 | 620 | 5.0E-15 |
| sp|Q8A463|EFTU_BACTN | Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 | 283 | 620 | 5.0E-15 |
| sp|Q8BFR5|EFTU_MOUSE | Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 | 283 | 619 | 5.0E-15 |
| sp|Q5FTY1|EFTU_GLUOX | Elongation factor Tu OS=Gluconobacter oxydans (strain 621H) GN=tuf PE=3 SV=1 | 283 | 619 | 5.0E-15 |
| sp|A4WVL0|EFTU_RHOS5 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tuf1 PE=3 SV=1 | 288 | 620 | 5.0E-15 |
| sp|A1KRF9|EFTU_NEIMF | Elongation factor Tu OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tuf1 PE=3 SV=1 | 288 | 620 | 5.0E-15 |
| sp|P64027|EFTU_NEIMB | Elongation factor Tu OS=Neisseria meningitidis serogroup B (strain MC58) GN=tufA PE=1 SV=1 | 288 | 620 | 5.0E-15 |
| sp|P64026|EFTU_NEIMA | Elongation factor Tu OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tufA PE=3 SV=1 | 288 | 620 | 5.0E-15 |
| sp|P74227|EFTU_SYNY3 | Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 | 288 | 620 | 5.0E-15 |
| sp|Q2GFN6|EFTU_EHRCR | Elongation factor Tu OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tuf1 PE=3 SV=1 | 288 | 620 | 5.0E-15 |
| sp|C4LL63|EFTU_CORK4 | Elongation factor Tu OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=tuf PE=3 SV=1 | 288 | 619 | 5.0E-15 |
| sp|Q8G5B7|EFTU_BIFLO | Elongation factor Tu OS=Bifidobacterium longum (strain NCC 2705) GN=tuf PE=3 SV=1 | 260 | 620 | 6.0E-15 |
| sp|B3DT29|EFTU_BIFLD | Elongation factor Tu OS=Bifidobacterium longum (strain DJO10A) GN=tuf PE=3 SV=1 | 260 | 620 | 6.0E-15 |
| sp|Q9P9Q9|EFTU_XYLFA | Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 | 288 | 620 | 6.0E-15 |
| sp|P26751|EF1A_PYRWO | Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 | 191 | 586 | 6.0E-15 |
| sp|Q055E6|EFTU_LEPBL | Elongation factor Tu OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=tuf1 PE=3 SV=1 | 288 | 620 | 6.0E-15 |
| sp|Q04PT6|EFTU_LEPBJ | Elongation factor Tu OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=tuf PE=3 SV=1 | 288 | 620 | 6.0E-15 |
| sp|B7GU46|EFTU_BIFLS | Elongation factor Tu OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=tuf PE=3 SV=1 | 260 | 620 | 6.0E-15 |
| sp|C4Z2R9|EFTU_EUBE2 | Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-15 |
| sp|Q6CZW6|EFTU_PECAS | Elongation factor Tu OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tuf1 PE=3 SV=1 | 284 | 620 | 7.0E-15 |
| sp|Q5GRY3|EFTU2_WOLTR | Elongation factor Tu 2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf2 PE=3 SV=1 | 288 | 620 | 7.0E-15 |
| sp|Q7VRP0|EFTU_BLOFL | Elongation factor Tu OS=Blochmannia floridanus GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-15 |
| sp|A1A0T1|EFTU_BIFAA | Elongation factor Tu OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=tuf PE=3 SV=1 | 260 | 620 | 7.0E-15 |
| sp|Q2S8Z8|EFTU_HAHCH | Elongation factor Tu OS=Hahella chejuensis (strain KCTC 2396) GN=tuf1 PE=3 SV=1 | 288 | 620 | 7.0E-15 |
| sp|Q9TMM9|EFTU_TOXGO | Elongation factor Tu, apicoplast OS=Toxoplasma gondii GN=tufA PE=3 SV=1 | 283 | 620 | 7.0E-15 |
| sp|C4ZB99|EFTU_EUBR3 | Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 | 288 | 620 | 7.0E-15 |
| sp|Q889X3|EFTU_PSESM | Elongation factor Tu OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tuf PE=3 SV=1 | 283 | 620 | 8.0E-15 |
| sp|Q5P334|EFTU_AROAE | Elongation factor Tu OS=Aromatoleum aromaticum (strain EbN1) GN=tuf1 PE=3 SV=1 | 283 | 620 | 8.0E-15 |
| sp|Q6NJD5|EFTU_CORDI | Elongation factor Tu OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=tuf PE=3 SV=1 | 288 | 620 | 8.0E-15 |
| sp|Q5GSU2|EFTU1_WOLTR | Elongation factor Tu 1 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tuf1 PE=3 SV=1 | 288 | 620 | 8.0E-15 |
| sp|A8EW02|EFTU_ARCB4 | Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 | 283 | 620 | 8.0E-15 |
| sp|P50372|EFTU_CODFR | Elongation factor Tu, chloroplastic OS=Codium fragile GN=tufA PE=3 SV=1 | 189 | 620 | 8.0E-15 |
| sp|Q5PBH1|EFTU_ANAMM | Elongation factor Tu OS=Anaplasma marginale (strain St. Maries) GN=tuf1 PE=3 SV=1 | 288 | 620 | 8.0E-15 |
| sp|Q1H4N9|EFTU2_METFK | Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 | 288 | 620 | 9.0E-15 |
| sp|Q6AP73|EFTU2_DESPS | Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 | 191 | 620 | 9.0E-15 |
| sp|Q3J5S4|EFTU_RHOS4 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tuf1 PE=3 SV=1 | 288 | 620 | 9.0E-15 |
| sp|A3PGI1|EFTU_RHOS1 | Elongation factor Tu OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tuf1 PE=3 SV=1 | 288 | 620 | 9.0E-15 |
| sp|P50068|EFTU_UREPA | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=tuf PE=3 SV=1 | 288 | 618 | 9.0E-15 |
| sp|B1AJG3|EFTU_UREP2 | Elongation factor Tu OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=tuf PE=3 SV=1 | 288 | 618 | 9.0E-15 |
| sp|Q2EEV7|EFTU_HELSJ | Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 | 189 | 620 | 9.0E-15 |
| sp|A5FIJ9|EFTU_FLAJ1 | Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 | 283 | 620 | 9.0E-15 |
| sp|Q1H4Q1|EFTU1_METFK | Elongation factor Tu 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf1 PE=3 SV=1 | 288 | 620 | 1.0E-14 |
| sp|A7Z0N5|EFTU_BACMF | Elongation factor Tu OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tuf PE=3 SV=1 | 288 | 619 | 1.0E-14 |
| sp|A4JAM5|EFTU_BURVG | Elongation factor Tu OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tuf1 PE=3 SV=1 | 283 | 620 | 1.0E-14 |
| sp|Q8EK70|EFTU2_SHEON | Elongation factor Tu 2 OS=Shewanella oneidensis (strain MR-1) GN=tuf2 PE=3 SV=1 | 288 | 620 | 1.0E-14 |
| sp|Q57770|EF1A_METJA | Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 | 191 | 589 | 1.0E-14 |
| sp|Q0ABH7|EFTU_ALKEH | Elongation factor Tu OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tuf1 PE=3 SV=1 | 288 | 620 | 1.0E-14 |
| sp|A6MW28|EFTU_RHDSA | Elongation factor Tu, chloroplastic OS=Rhodomonas salina GN=tufA PE=3 SV=1 | 283 | 620 | 1.0E-14 |
| sp|C6C171|EFTU_DESAD | Elongation factor Tu OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=tuf PE=3 SV=1 | 284 | 620 | 1.0E-14 |
| sp|Q65PA9|EFTU_BACLD | Elongation factor Tu OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tuf PE=3 SV=1 | 288 | 620 | 1.0E-14 |
| sp|Q11Q98|EFTU_CYTH3 | Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 | 191 | 620 | 1.0E-14 |
| sp|P86933|EF1A_TRYBB | Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 | 197 | 606 | 1.0E-14 |
| sp|A1TYJ5|EFTU_MARHV | Elongation factor Tu OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tuf PE=3 SV=1 | 191 | 620 | 1.0E-14 |
| sp|Q464Z4|EF1A_METBF | Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 | 191 | 572 | 1.0E-14 |
| sp|O31301|EFTU_BUCSC | Elongation factor Tu (Fragment) OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=tuf PE=3 SV=1 | 288 | 608 | 1.0E-14 |
| sp|O31298|EFTU_BUCAP | Elongation factor Tu OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tuf PE=3 SV=2 | 288 | 620 | 1.0E-14 |
| sp|Q0HNT9|EFTU2_SHESM | Elongation factor Tu 2 OS=Shewanella sp. (strain MR-4) GN=tuf2 PE=3 SV=1 | 288 | 620 | 1.0E-14 |
| sp|P29543|EFTU2_STRRA | Elongation factor Tu-2 OS=Streptomyces ramocissimus GN=tuf2 PE=3 SV=1 | 284 | 620 | 2.0E-14 |
| sp|P42481|EFTU_THIDL | Elongation factor Tu OS=Thiomonas delicata GN=tuf PE=3 SV=1 | 283 | 620 | 2.0E-14 |
| sp|B8D851|EFTU_BUCAT | Elongation factor Tu OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=tuf PE=3 SV=1 | 290 | 620 | 2.0E-14 |
| sp|O31297|EFTU_BUCAI | Elongation factor Tu OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tuf PE=3 SV=2 | 290 | 620 | 2.0E-14 |
| sp|B8D9U9|EFTU_BUCA5 | Elongation factor Tu OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=tuf PE=3 SV=1 | 290 | 620 | 2.0E-14 |
| sp|Q39KI2|EFTU_BURL3 | Elongation factor Tu OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-14 |
| sp|Q0BJ48|EFTU_BURCM | Elongation factor Tu OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-14 |
| sp|A0K3L0|EFTU_BURCH | Elongation factor Tu OS=Burkholderia cenocepacia (strain HI2424) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-14 |
| sp|Q1BRT3|EFTU_BURCA | Elongation factor Tu OS=Burkholderia cenocepacia (strain AU 1054) GN=tuf1 PE=3 SV=1 | 283 | 620 | 2.0E-14 |
| sp|Q2HJN4|EF1A1_OSCTI | Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 | 193 | 588 | 2.0E-14 |
| sp|Q85FT7|EFTU_CYAME | Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1 | 288 | 620 | 2.0E-14 |
| sp|Q2NQL7|EFTU_SODGM | Elongation factor Tu OS=Sodalis glossinidius (strain morsitans) GN=tuf1 PE=3 SV=1 | 288 | 620 | 2.0E-14 |
| sp|B8HVR7|EFTU_CYAP4 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tuf PE=3 SV=1 | 288 | 620 | 2.0E-14 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005525 | GTP binding | Yes |
| GO:0003924 | GTPase activity | Yes |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0043168 | anion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0003674 | molecular_function | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0000166 | nucleotide binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | Nuclear localization signal | 0.5255 | 0.5127 | 0.027 | 0.046 | 0.1957 | 0.0355 | 0.1609 | 0.154 | 0.2019 | 0.0052 |
| Orthofinder run ID | 1 |
| Orthogroup | 3762 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|046040 |
| Agaricus bisporus var bisporus H97 | AgabiH97|046040 (this protein) |
| Rhodonia placenta FPRL280 | RhoplFPRL280|10_37 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|046040 MTTLRTFQTEIDEIHNREVAKQRTLASTLPEKEGHDRRNASAAKGKARNDITSPSSAVSQSTRSGNAAPVSLIEL EDRITNYVLMSSPADHAMGRDMIAELLTQNHGEYVFRIGAQPPHAALFTEELTDTTDGWLGTERTPEQITEIRRV LENLVDEVGGKVSLLYESLNGAHPRSNLLLRLPPPNVSLTPEVRCAVVGNVDSGKSTTLGVLTRGSLDDGRGKAR VALFRHKHELETGRTSSVGMEILGFGPLGTPILPQTISKDENVTRHEKLGWEEISLQAAKIVSFIDLAGHERYLK TTLYGLTSGAPSCVILIVGANAGLIGMSKEHLAIALALGVPVVVCITKIDMTPAPKLEETLKQVTKILQSPGCRK TPVFVKNIETSVELATSFGPEKICPIFQISNVTGEGFDHLRTFLNLLPSSEHDVTKFAIDQPLEISIIETWSVPY VGTVVNGIVNSGTVKVGDAVLLGPDANGNYRVTAIKSMHRKRTIVTTAEAGQCVSLALKRVKRAEVRKGMVIVPR TDTPPRAVSRFEGQVLILYHNTTLQRNYQAMLHCGAVRQTVRMIEMDHPQGVLRTGDRAKVEFEFISHPEHVKEG MKLLFREGKTKGLGVITKIL* |
| Coding | >AgabiH97|046040 ATGACGACTCTAAGGACATTCCAGACCGAGATAGATGAAATCCATAATCGGGAGGTAGCCAAGCAGAGAACACTG GCCTCTACATTACCAGAGAAAGAGGGCCATGACCGAAGAAACGCGTCCGCAGCGAAAGGCAAGGCCAGGAATGAT ATCACAAGTCCTTCATCCGCAGTCTCTCAATCTACAAGAAGTGGCAATGCCGCTCCGGTGTCATTGATAGAACTC GAGGATCGTATAACGAATTACGTCTTGATGAGCAGTCCAGCTGATCACGCAATGGGGAGAGATATGATCGCCGAG CTACTGACCCAAAATCACGGCGAATATGTGTTTCGGATAGGAGCTCAACCACCTCACGCAGCACTGTTCACAGAA GAACTCACAGATACGACTGACGGTTGGCTGGGTACGGAGAGAACCCCAGAACAGATCACCGAAATCAGAAGAGTA TTGGAAAATCTCGTAGACGAGGTTGGAGGAAAGGTTTCACTCCTATATGAGTCACTAAACGGGGCACACCCTCGA TCTAACTTACTATTGCGACTCCCCCCTCCAAATGTATCTCTCACTCCTGAGGTTCGATGTGCGGTAGTCGGTAAT GTCGACAGTGGCAAGTCAACCACACTTGGAGTGTTGACTAGAGGATCTCTTGATGATGGTAGAGGGAAGGCACGC GTTGCTCTCTTCAGACATAAGCATGAATTAGAGACAGGAAGAACTTCCAGCGTCGGAATGGAGATCCTAGGATTT GGGCCTCTTGGAACGCCAATTTTACCTCAAACGATCAGCAAAGATGAGAATGTGACGAGACACGAAAAGCTAGGC TGGGAAGAGATTTCTCTACAGGCAGCCAAAATTGTGTCTTTTATAGATCTAGCCGGGCATGAACGATATCTCAAA ACGACTCTATACGGCCTCACTTCCGGTGCTCCTTCTTGCGTCATTTTAATAGTTGGTGCAAATGCTGGATTGATT GGAATGTCCAAGGAACATCTGGCAATAGCTCTAGCTCTCGGCGTTCCAGTAGTTGTTTGTATAACAAAGATTGAT ATGACCCCAGCTCCAAAGCTGGAAGAAACGTTGAAGCAGGTTACCAAAATATTGCAAAGTCCTGGTTGTAGAAAG ACTCCAGTATTCGTCAAAAACATTGAGACGTCAGTCGAACTCGCCACGTCTTTTGGTCCTGAGAAGATATGTCCA ATATTTCAGATCTCGAATGTTACAGGCGAAGGTTTTGATCATCTCCGAACATTCCTTAACCTGTTACCCTCTAGT GAACATGATGTTACGAAATTTGCGATAGATCAACCACTAGAGATTTCCATTATAGAAACGTGGTCTGTCCCCTAC GTTGGGACAGTGGTGAACGGTATTGTCAATTCTGGGACGGTCAAAGTTGGAGACGCGGTCCTTCTCGGACCAGAT GCCAACGGCAATTACCGCGTCACCGCGATAAAAAGTATGCACCGTAAACGTACCATTGTTACCACAGCAGAAGCA GGACAATGCGTCTCCCTTGCGCTGAAACGCGTCAAACGTGCAGAAGTACGGAAAGGGATGGTTATAGTACCCAGG ACGGATACACCACCTCGAGCCGTCTCGCGATTTGAAGGCCAAGTCCTCATTCTATATCATAACACGACGTTGCAA CGCAATTATCAGGCTATGTTGCACTGCGGCGCTGTGCGACAAACAGTTCGCATGATTGAGATGGATCACCCACAG GGTGTTCTGCGCACTGGAGATCGTGCGAAAGTTGAATTTGAATTCATCTCGCATCCCGAGCACGTCAAGGAGGGT ATGAAGCTGCTCTTTCGCGAGGGGAAAACGAAGGGTCTTGGTGTCATTACGAAAATACTATAA |
| Transcript | >AgabiH97|046040 ATGACGACTCTAAGGACATTCCAGACCGAGATAGATGAAATCCATAATCGGGAGGTAGCCAAGCAGAGAACACTG GCCTCTACATTACCAGAGAAAGAGGGCCATGACCGAAGAAACGCGTCCGCAGCGAAAGGCAAGGCCAGGAATGAT ATCACAAGTCCTTCATCCGCAGTCTCTCAATCTACAAGAAGTGGCAATGCCGCTCCGGTGTCATTGATAGAACTC GAGGATCGTATAACGAATTACGTCTTGATGAGCAGTCCAGCTGATCACGCAATGGGGAGAGATATGATCGCCGAG CTACTGACCCAAAATCACGGCGAATATGTGTTTCGGATAGGAGCTCAACCACCTCACGCAGCACTGTTCACAGAA GAACTCACAGATACGACTGACGGTTGGCTGGGTACGGAGAGAACCCCAGAACAGATCACCGAAATCAGAAGAGTA TTGGAAAATCTCGTAGACGAGGTTGGAGGAAAGGTTTCACTCCTATATGAGTCACTAAACGGGGCACACCCTCGA TCTAACTTACTATTGCGACTCCCCCCTCCAAATGTATCTCTCACTCCTGAGGTTCGATGTGCGGTAGTCGGTAAT GTCGACAGTGGCAAGTCAACCACACTTGGAGTGTTGACTAGAGGATCTCTTGATGATGGTAGAGGGAAGGCACGC GTTGCTCTCTTCAGACATAAGCATGAATTAGAGACAGGAAGAACTTCCAGCGTCGGAATGGAGATCCTAGGATTT GGGCCTCTTGGAACGCCAATTTTACCTCAAACGATCAGCAAAGATGAGAATGTGACGAGACACGAAAAGCTAGGC TGGGAAGAGATTTCTCTACAGGCAGCCAAAATTGTGTCTTTTATAGATCTAGCCGGGCATGAACGATATCTCAAA ACGACTCTATACGGCCTCACTTCCGGTGCTCCTTCTTGCGTCATTTTAATAGTTGGTGCAAATGCTGGATTGATT GGAATGTCCAAGGAACATCTGGCAATAGCTCTAGCTCTCGGCGTTCCAGTAGTTGTTTGTATAACAAAGATTGAT ATGACCCCAGCTCCAAAGCTGGAAGAAACGTTGAAGCAGGTTACCAAAATATTGCAAAGTCCTGGTTGTAGAAAG ACTCCAGTATTCGTCAAAAACATTGAGACGTCAGTCGAACTCGCCACGTCTTTTGGTCCTGAGAAGATATGTCCA ATATTTCAGATCTCGAATGTTACAGGCGAAGGTTTTGATCATCTCCGAACATTCCTTAACCTGTTACCCTCTAGT GAACATGATGTTACGAAATTTGCGATAGATCAACCACTAGAGATTTCCATTATAGAAACGTGGTCTGTCCCCTAC GTTGGGACAGTGGTGAACGGTATTGTCAATTCTGGGACGGTCAAAGTTGGAGACGCGGTCCTTCTCGGACCAGAT GCCAACGGCAATTACCGCGTCACCGCGATAAAAAGTATGCACCGTAAACGTACCATTGTTACCACAGCAGAAGCA GGACAATGCGTCTCCCTTGCGCTGAAACGCGTCAAACGTGCAGAAGTACGGAAAGGGATGGTTATAGTACCCAGG ACGGATACACCACCTCGAGCCGTCTCGCGATTTGAAGGCCAAGTCCTCATTCTATATCATAACACGACGTTGCAA CGCAATTATCAGGCTATGTTGCACTGCGGCGCTGTGCGACAAACAGTTCGCATGATTGAGATGGATCACCCACAG GGTGTTCTGCGCACTGGAGATCGTGCGAAAGTTGAATTTGAATTCATCTCGCATCCCGAGCACGTCAAGGAGGGT ATGAAGCTGCTCTTTCGCGAGGGGAAAACGAAGGGTCTTGGTGTCATTACGAAAATACTATAA |
| Gene | >AgabiH97|046040 ATGACGACTCTAAGGACATTCCAGACCGAGATAGATGAAATCCATAATCGGGAGGTAGCCAAGCAGAGAACACTG GCCTCTACATTACCAGAGAAAGAGGGCCATGACCGAAGAAACGCGTCCGCAGCGAAAGGCAAGGCCAGGAATGAT ATCACAAGTCCTTCATCCGCAGTCTCTCAATCTACAAGAAGTGGCAATGCCGCTCCGGTGTCATTGATAGAACTC GAGGATCGTATAACGGTATGACGACCTGCTTCATGATCGTGGTGTATGCTGAGAAAAGCTGCCAACACTTAATGC ATTGTGGTTTCGGTGATCATCTCCCAGAATTACGTCTTGATGAGCAGTCCAGCTGATCACGCAATGGGGAGAGAT ATGATCGCCGAGCTACTGACCCAAAATCACGGCGAATATGTGTTTCGGATAGGAGCTCAACCACCTCACGCAGCA CTGTTCACAGAAGAACTCACAGATACGACTGACGGTTGGCTGGGTACGGAGAGAACCCCAGAACAGATCACCGAA ATCAGAAGAGTATTGGAAAATCTCGTAGACGAGGTTGGAGGAAAGGTGTTATTTCTCTTCTTTTTTGATGTTATC AAACTAATCACTTAGTGACAGGTTTCACTCCTATATGAGTCACTAAACGGGGCACACCCTCGATCTAACTTACTA TTGCGACTCCCCCCTCCAAATGTATCTCTCACTCCTGAGGTTCGATGTGCGGTAGTCGGTAATGTCGACAGTGGC AAGTCAACCACACTTGGAGTGTTGACTAGAGGTGAGATCTTTACTGCGACTATTTCATACACCCCCTCATGAGTG CATAGGATCTCTTGATGATGGTAGAGGGAAGGCACGCGTTGCTCTCTTCAGACATAAGCATGAATTAGAGACAGG AAGAACTTCCAGCGTCGGAATGGAGGTATGGTAAAGGAACATTGAGTATCACCTCTAACAGCTGTTTAGATCCTA GGATTTGGGCCTCTTGGAACGCCAATTTTACCTCAAACGATCAGCAAAGATGAGAATGTGACGAGACACGAAAAG CTAGGCTGGGAAGAGATTTCTCTACAGGCAGCCAAAATTGTGTCTTTTATAGGTATGTTCTCGCTTTTAAATCGA ACATCTGTCTAACAAATTCCAGATCTAGCCGGGCATGAACGATATCTCAAAACGACTCTATACGGCCTCACTTCC GGTGCTCCTTCTTGCGTCATTTTAATAGTTGGTGCAAATGCTGGATTGATTGGAATGTCCAAGGAACATCTGGCA ATAGCTCTAGCTCTCGGCGTTCCAGTAGTTGTTTGTATAACAAAGGTTGGTCTGTTAGCTGATTCTACCGTCGAC AATGAGTGACTCTTCTAAAGATTGATATGACCCCAGCTCCAAAGCTGGAAGAAACGTTGAAGCAGGTTACCAAAA TATTGCAAAGTCCTGGTTGTAGGTTAGTGGTCAAAGTTCGGGCAGGTGCAACATCCTGATTTTTCGGTTAGAAAG ACTCCAGTATTCGTCAAAAACATTGAGACGTCAGTCGAACTCGCCACGTCTTTTGGTCCTGAGAAGTGAGCCACT TTTACCAAGTTTGCCAACTCAAATCTAGACACAAAGCAGGATATGTCCAATATTTCAGATCTCGAATGTTACAGG CGAAGGTTTTGATCATGTGAAAAGCTTCCTAAGAGTAGTGGTCGTTACATTAACATTGTTCTCATCTTACAGCTC CGAACATTCCTTAACCTGTTACCCTCTAGTGAACATGATGTTACGAAATTTGCGATAGATCAACCACTAGAGGTG AGCAATCTTTAGTCTGACAATGTCAGTGGCTGAGGAGGATGCGAGATTTCCATTATAGAAACGTGGTCTGTCCCC TACGTTGGGACAGTGGTGAACGGTATTGTCAATTCTGGGACGGTCAAAGTTGGAGACGCGGTCCTTCTCGGACCA GATGCCAACGGCAATTACCGCGTCACCGCGATAAAAAGTATGCACCGTAAACGGTGAGACTGCTCCCTTCATTTG GCGTGCGGTCAATTGAACTCGCCCCGCAAAGTACCATTGTTACCACAGCAGAAGCAGGACAATGCGTCTCCCTTG CGCTGAAACGCGTCAAACGTGCAGAAGTACGGAAAGGGATGGTTATAGTACCCAGGACGGATACACCACCTCGAG GTATGTTGTATGTTTTATTGTCTCCGGATACTTCTTTAAACAATCTCTACAGCCGTCTCGCGATTTGAAGGCCAA GTCCTCATTCTATAGTACGGTTATTCTCGTTTTTCAGTTATGCCAAGACCCTAAATTCAATCAGTCATAACACGA CGTTGCAACGCAATTATCAGGTATGCCATGACTGTGAACCGTATGCTTTCTGACTGCAAAGCGATTAGGCTATGT TGCACTGCGGCGTAAGTTTTGATCTCAAACGGTTGATTTGGCTCAATGACTAAGTGGTATTTTTAGGCTGTGCGA CAAACAGTTCGCATGATTGAGATGGATCACCCACAGGGTGTTCTGCGCACTGGAGATCGTGCGAAAGTTGAATTT GAATTCATCTCGCATCCCGAGCACGTCAAGGAGGGTATGAAGCTGCTCTTTCGCGAGGGGAAAACGAAGGTCTGC CATTAGATGCTTTATATCTGGAATCAAAATCTCATTGCCGTGGCAGGGTCTTGGTGTCATTACGAAAATACTATA A |