Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045830
Gene name
Locationscaffold_2:1809617..1811690
Strand-
Gene length (bp)2073
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 4.9E-37 117 413
PF00734 CBM_1 Fungal cellulose binding domain 6.4E-13 33 60
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 6.9E-05 229 412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 17 428 1.0E-96
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 17 428 1.0E-96
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 11 447 2.0E-94
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 12 428 5.0E-91
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 12 428 5.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 17 428 1.0E-96
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 17 428 1.0E-96
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 11 447 2.0E-94
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 12 428 5.0E-91
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 12 428 5.0E-91
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 12 428 6.0E-91
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 19 428 3.0E-89
sp|A1D8Y6|MANA_NEOFI Probable mannan endo-1,4-beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manA PE=3 SV=1 96 447 5.0E-85
sp|Q00012|MANA_ASPAC Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus GN=manA PE=1 SV=1 83 448 9.0E-83
sp|B8NVK8|MANA_ASPFN Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manA PE=3 SV=2 96 447 2.0E-82
sp|Q2TXJ2|MANA_ASPOR Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manA PE=3 SV=1 96 447 6.0E-82
sp|A2QKT4|MANA_ASPNC Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=manA PE=1 SV=1 101 444 4.0E-80
sp|Q5AVP1|MAND_EMENI Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manD PE=3 SV=1 99 428 1.0E-78
sp|A1CGC6|MANA_ASPCL Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manA PE=3 SV=1 80 447 1.0E-77
sp|Q0CCD0|MANA1_ASPTN Probable mannan endo-1,4-beta-mannosidase A-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-1 PE=3 SV=1 75 448 2.0E-77
sp|Q0C8J3|MANC_ASPTN Probable mannan endo-1,4-beta-mannosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manC PE=3 SV=1 92 445 5.0E-74
sp|Q5B7X2|MANA_EMENI Mannan endo-1,4-beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manA PE=1 SV=1 93 448 1.0E-73
sp|Q0CUG5|MANA2_ASPTN Probable mannan endo-1,4-beta-mannosidase A-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-2 PE=3 SV=2 92 444 5.0E-72
sp|Q5AZ53|MANC_EMENI Mannan endo-1,4-beta-mannosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manC PE=2 SV=1 95 444 7.0E-70
sp|Q5B833|MANB_EMENI Mannan endo-1,4-beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manB PE=2 SV=2 98 447 1.0E-67
sp|Q8L5J1|MAN4_SOLLC Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lycopersicum GN=MAN4 PE=1 SV=2 96 427 3.0E-50
sp|Q0JKM9|MAN1_ORYSJ Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica GN=MAN1 PE=2 SV=2 96 427 6.0E-50
sp|Q9FZ29|MAN1_ARATH Mannan endo-1,4-beta-mannosidase 1 OS=Arabidopsis thaliana GN=MAN1 PE=2 SV=1 92 446 3.0E-48
sp|Q9FJZ3|MAN7_ARATH Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana GN=MAN7 PE=2 SV=1 93 388 3.0E-47
sp|Q9SG95|MAN4_ARATH Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana GN=MAN4 PE=3 SV=1 93 388 3.0E-47
sp|Q9M0H6|MAN5_ARATH Mannan endo-1,4-beta-mannosidase 5 OS=Arabidopsis thaliana GN=MAN5 PE=2 SV=1 93 444 2.0E-45
sp|Q9SG94|MAN3_ARATH Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis thaliana GN=MAN3 PE=2 SV=1 80 388 3.0E-45
sp|O48540|MAN1_SOLLC Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum GN=MAN1 PE=1 SV=2 93 427 6.0E-45
sp|Q9LZV3|MAN6_ARATH Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana GN=MAN6 PE=2 SV=1 97 428 6.0E-45
sp|Q9LW44|MANP_ARATH Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana GN=MANP PE=5 SV=3 93 388 1.0E-44
sp|Q0JJD4|MAN2_ORYSJ Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica GN=MAN2 PE=2 SV=2 96 429 1.0E-43
sp|Q7Y223|MAN2_ARATH Mannan endo-1,4-beta-mannosidase 2 OS=Arabidopsis thaliana GN=MAN2 PE=2 SV=1 96 429 5.0E-43
sp|Q6YM50|MAN5_SOLLC Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum GN=MAN5 PE=2 SV=1 95 427 9.0E-43
sp|Q9FZ03|MAN2_SOLLC Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum GN=MAN2 PE=2 SV=2 95 427 9.0E-43
sp|Q6Z310|MAN9_ORYSJ Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica GN=MAN9 PE=2 SV=2 96 427 2.0E-42
sp|Q9FUQ6|MAN3_SOLLC Mannan endo-1,4-beta-mannosidase 3 OS=Solanum lycopersicum GN=MAN3 PE=3 SV=1 93 427 7.0E-41
sp|Q5W6G0|MAN5_ORYSJ Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica GN=MAN5 PE=2 SV=2 95 386 4.0E-36
sp|Q2RBB1|MAN7_ORYSJ Mannan endo-1,4-beta-mannosidase 7 OS=Oryza sativa subsp. japonica GN=MAN7 PE=2 SV=3 96 445 2.0E-34
sp|Q10B67|MAN4_ORYSJ Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica GN=MAN4 PE=2 SV=2 95 382 1.0E-32
sp|Q0IQJ7|MAN8_ORYSJ Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica GN=MAN8 PE=2 SV=2 96 445 2.0E-32
sp|Q0DCM5|MAN6_ORYSJ Mannan endo-1,4-beta-mannosidase 6 OS=Oryza sativa subsp. japonica GN=MAN6 PE=2 SV=2 96 382 2.0E-31
sp|Q0DM48|MAN3_ORYSJ Mannan endo-1,4-beta-mannosidase 3 OS=Oryza sativa subsp. japonica GN=MAN3 PE=2 SV=2 100 382 9.0E-28
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 23 263 1.0E-15
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 28 263 1.0E-13
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 13 261 1.0E-13
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 13 262 4.0E-13
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 13 262 4.0E-13
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 32 71 3.0E-12
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 25 65 1.0E-11
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 32 104 1.0E-10
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 31 67 3.0E-10
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 33 66 2.0E-09
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 17 74 2.0E-09
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 33 64 2.0E-09
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 12 65 4.0E-09
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 15 262 6.0E-09
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 11 66 1.0E-08
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 11 66 1.0E-08
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 33 64 2.0E-08
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 18 80 3.0E-08
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 11 66 3.0E-08
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 33 64 4.0E-08
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 17 67 4.0E-08
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 32 71 2.0E-07
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 12 66 2.0E-07
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 33 64 2.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 33 64 2.0E-07
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 32 65 2.0E-07
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 32 66 2.0E-07
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 33 64 3.0E-07
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 32 65 8.0E-07
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 23 67 8.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 33 64 1.0E-06
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 32 64 2.0E-06
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 33 64 3.0E-06
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 17 65 4.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 33 64 5.0E-06
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 33 64 6.0E-06
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 32 64 7.0E-06
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 32 64 9.0E-06
sp|Q9P7F1|YKK5_SCHPO Carbohydrate-binding domain-containing protein C2E1P3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.05c PE=3 SV=1 13 65 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0030247 polysaccharide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045830
MACQGVCVRYKRQTRFIILAISISLATADVPVWGQCGGRGWTGETACASGSSCVVQNEWYSQCLPGSTTPTNPPP
TTTTSQTTAPPATSHPVSTGFVKASGTRFTLNGQKYTVVGGNSYWVGLTGLSTSAMNQAFSDIANAGGTTVRTWG
FNEVTSPNGNYYQSWSGARPTINTGASGLLNFDNVIAAAKANGIRLIVALTNNWADYGGMDVYVNQMVGNGQPHD
LFYTNTAIKDAFKSYVRVFVSRYANEPTVMAWELANEPRCKGSTGTTSGTCTTTTVTNWAKEMSAFIKTIDSNHL
VAIGDEGFYNQPGAPTYPYQGSEGVDFEANLAISSVDFATFHSYPEPWGQGADAKAWGTQWITDHAASMKRVNKP
VILEEFGVTTNQPDTYAEWFNEVESSGLTGDLIWQAGSHLSTGDTHNDGYAVYPDGPVYPLLKSHASAMKNRA*
Coding >AgabiH97|045830
ATGGCGTGTCAAGGCGTTTGTGTCCGTTATAAAAGACAGACTAGATTCATTATTTTGGCTATTTCTATCTCTCTA
GCGACCGCAGATGTTCCAGTCTGGGGTCAGTGCGGTGGCAGGGGTTGGACGGGAGAGACAGCTTGTGCAAGTGGA
TCATCTTGTGTCGTGCAGAACGAATGGTACTCGCAGTGCCTCCCTGGATCAACAACTCCAACAAACCCTCCCCCT
ACCACTACCACCTCCCAAACTACCGCTCCTCCTGCCACTTCACACCCAGTGTCGACCGGATTTGTCAAAGCTTCT
GGTACCAGATTCACTCTAAATGGCCAAAAATACACCGTTGTTGGAGGTAATTCCTACTGGGTCGGTTTAACTGGG
CTCAGCACCAGTGCAATGAATCAGGCTTTCTCTGACATTGCTAACGCTGGAGGAACAACCGTCCGAACATGGGGA
TTCAATGAAGTAACCTCGCCAAACGGCAATTATTATCAATCCTGGTCTGGTGCCAGACCTACTATAAACACTGGA
GCGTCTGGTCTACTTAATTTCGACAATGTGATTGCTGCGGCCAAGGCAAATGGAATTCGTCTGATAGTTGCTCTG
ACGAATAATTGGGCGGACTATGGTGGCATGGACGTCTATGTCAACCAGATGGTGGGCAATGGCCAACCACACGAT
CTTTTCTACACAAACACCGCAATCAAGGACGCGTTCAAATCTTATGTCCGGGTCTTCGTGAGTCGCTATGCCAAC
GAACCTACCGTAATGGCTTGGGAGCTTGCAAATGAGCCGAGGTGCAAAGGTAGCACCGGCACGACTTCTGGAACC
TGTACAACTACGACCGTCACGAATTGGGCCAAGGAGATGTCGGCGTTTATTAAAACCATTGATAGCAACCATCTC
GTTGCTATTGGTGATGAGGGTTTCTATAATCAACCCGGTGCTCCAACTTATCCATACCAAGGAAGCGAAGGTGTT
GATTTCGAAGCTAATCTCGCCATCTCCTCTGTCGACTTTGCGACCTTCCATTCCTATCCGGAACCGTGGGGACAG
GGTGCCGATGCAAAAGCCTGGGGCACTCAATGGATTACAGATCATGCTGCCAGTATGAAGAGGGTCAACAAACCC
GTTATCCTTGAAGAATTCGGTGTAACTACCAATCAACCTGATACTTACGCTGAGTGGTTCAACGAGGTAGAATCA
TCAGGGTTGACTGGTGATCTCATTTGGCAAGCCGGTTCTCACTTGTCTACGGGAGATACACACAATGACGGTTAT
GCTGTCTACCCCGATGGTCCAGTATACCCGTTACTGAAGTCGCATGCAAGTGCAATGAAAAACCGGGCTTGA
Transcript >AgabiH97|045830
ATGGCGTGTCAAGGCGTTTGTGTCCGTTATAAAAGACAGACTAGATTCATTATTTTGGCTATTTCTATCTCTCTA
GCGACCGCAGATGTTCCAGTCTGGGGTCAGTGCGGTGGCAGGGGTTGGACGGGAGAGACAGCTTGTGCAAGTGGA
TCATCTTGTGTCGTGCAGAACGAATGGTACTCGCAGTGCCTCCCTGGATCAACAACTCCAACAAACCCTCCCCCT
ACCACTACCACCTCCCAAACTACCGCTCCTCCTGCCACTTCACACCCAGTGTCGACCGGATTTGTCAAAGCTTCT
GGTACCAGATTCACTCTAAATGGCCAAAAATACACCGTTGTTGGAGGTAATTCCTACTGGGTCGGTTTAACTGGG
CTCAGCACCAGTGCAATGAATCAGGCTTTCTCTGACATTGCTAACGCTGGAGGAACAACCGTCCGAACATGGGGA
TTCAATGAAGTAACCTCGCCAAACGGCAATTATTATCAATCCTGGTCTGGTGCCAGACCTACTATAAACACTGGA
GCGTCTGGTCTACTTAATTTCGACAATGTGATTGCTGCGGCCAAGGCAAATGGAATTCGTCTGATAGTTGCTCTG
ACGAATAATTGGGCGGACTATGGTGGCATGGACGTCTATGTCAACCAGATGGTGGGCAATGGCCAACCACACGAT
CTTTTCTACACAAACACCGCAATCAAGGACGCGTTCAAATCTTATGTCCGGGTCTTCGTGAGTCGCTATGCCAAC
GAACCTACCGTAATGGCTTGGGAGCTTGCAAATGAGCCGAGGTGCAAAGGTAGCACCGGCACGACTTCTGGAACC
TGTACAACTACGACCGTCACGAATTGGGCCAAGGAGATGTCGGCGTTTATTAAAACCATTGATAGCAACCATCTC
GTTGCTATTGGTGATGAGGGTTTCTATAATCAACCCGGTGCTCCAACTTATCCATACCAAGGAAGCGAAGGTGTT
GATTTCGAAGCTAATCTCGCCATCTCCTCTGTCGACTTTGCGACCTTCCATTCCTATCCGGAACCGTGGGGACAG
GGTGCCGATGCAAAAGCCTGGGGCACTCAATGGATTACAGATCATGCTGCCAGTATGAAGAGGGTCAACAAACCC
GTTATCCTTGAAGAATTCGGTGTAACTACCAATCAACCTGATACTTACGCTGAGTGGTTCAACGAGGTAGAATCA
TCAGGGTTGACTGGTGATCTCATTTGGCAAGCCGGTTCTCACTTGTCTACGGGAGATACACACAATGACGGTTAT
GCTGTCTACCCCGATGGTCCAGTATACCCGTTACTGAAGTCGCATGCAAGTGCAATGAAAAACCGGGCTTGA
Gene >AgabiH97|045830
ATGGCGTGTCAAGGCGTTTGTGTCCGTTATAAAAGACAGACTAGGTGACATGACTATTGCTCTGCAAATACCCTC
AGAAAATGAAGCCTGCGATTAGATTCATTATTTTGGCTATTTCTATCTCTCTAGCGACCGCAGATGTTCCAGTCT
GGGGTCAGTGCGGTGGCAGGGGTTGGACGGGAGAGACAGGTCAGTAATTCAACTAACTCGAGTCATCCTCGTAAT
CCTGAAAGAAAGATAGCTTGTGCAAGTGGATCATCTTGTGTCGTGCAGAACGAATGGTACTCGCAGTGCCTCCCT
GGATCAACAACTCCAACAAACCCTCCCCCTACCACTACCACCTCCCAAACTACCGCTCCTCCTGCCACTTCACAC
CCAGTGTCGACCGGATTTGTCAAAGCTTCTGGTACCAGATTCACTCTAAATGGCCAAAAATACACCGTTGTTGGG
TCCGTATTGTCTCTATCAGTACGTGAAGTGACTTATTGATTTTTTGCGTTTCTAGAGGTAATTCCTACTGGGTCG
GTTTAACTGGGCTCAGCACCAGTGCAATGAATCAGGCTTTCTCTGACATTGCTAACGCTGGAGGAACAACCGTCC
GAACATGGTAAATATCGTCATGGTGTTTGCGACTGAGATGTCATTAAAGCCCGAACTTATGATATACTAACAGGG
GATTCAATGAAGTAACCTCGCCAAACGGCAATTATTATCAATCCTGGTCTGGTGCCAGACCTACTATAAACACTG
GAGCGTCTGGTCTACTTAATTTCGGTAGGTGATATTTGATTGCGAAAAGGTACTTGGGGTAGATGGCTTAATACG
TTTTCTCAGACAATGTGATTGCTGCGGCCAAGGCAAATGGAATTCGTCTGATAGTTGCTCTGTGGGTTTCTTGCA
TTATGATGCGATATTGAAGCATGTATTGACTGATCCTTTGTTTCGGTTAGGACGAATAATTGGTAAGATGAATTA
GTCCTCGTACAACATCCACCGACCAAGGTAACCTATTTAGGGCGGACTATGGTGGCATGGACGTCTATGTCAACC
AGATGGTGGGCAATGGCCAACCACACGATCTTTTCTACACAAACACCGCAATCAAGGTGGGTAGTTCGCAAACGC
CTTGATACTTATCAATTGAACATCGTCTTAGGACGCGTTCAAATCTTATGTCCGGGTCTTCGTGAGTCGCTATGC
CAACGAACCTACCGTAATGGCTTGGGAGCTTGCAAATGAGCCGAGGTGCAAAGGTAGCACCGGGTGAGTTTTTTT
AGACCATAATTCGGTGTATTAATCTTAATTTCTGGAACTGACAGCACGACTTCTGGAACCTGTACAACTACGACC
GTCACGAATTGGGCCAAGGAGATGTCGGCGTTTATTAAAACCATTGATAGCAACCATCTCGTTGCTATTGGTGAT
GAGGGTTTCTATAATCAACCCGGTGCTCCAACTTATCCATACCAGTAAAGTATTTCATTCAATGCTTTTTCAGTG
AGTCTAAACAACGTGACATAGAGGAAGCGAAGGTGTTGATTTCGAAGCTAATCTCGCCATCTCCTCTGTCGACTT
TGCGACCTTCCATGTAAGGCTTTATTCCTATACTAGTATGGTCCCTTCTCTGACGTCAAGATTCTTCAAGTCCTA
TCCGGAACCGTGGGGACAGGGTGCCGATGCAAAAGCCTGGGGCACTCAATGGATTACAGATCATGCTGCCAGTAT
GAAGAGGGTCAACAAACCCGTTATCCTTGAAGAATTCGGTGTAACTACCAATCAACCTGATACTTACGCTGAGTG
GTTCAACGAGGTAGAATCATCAGGGTTGACTGGTGATCTCATTTGGTGCGTAGGTTTAGTTTAGCACGATCTTTA
CTGACAGATTCTCCGTGTGTAGGCAAGCCGGTTCTCACTTGTCTACGTTGGTTTTCTCTCTTTTCGTGCAAAGTT
GTTTGTATACTGATTTCCGGCAATAGGGGAGATACACACAATGACGGTTATGCTGTCTACCCCGATGGTCCAGTA
TACCCGTTACTGAAGTCGCATGCAAGTGCAATGAAAAACCGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail