Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045780
Gene name
Locationscaffold_2:1796307..1797958
Strand+
Gene length (bp)1651
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 4.9E-38 34 351

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6I3|YHG7_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.07c PE=3 SV=2 107 310 4.0E-14
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 100 303 7.0E-14
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 94 303 1.0E-13
sp|Q5ACZ2|DFG5_CANAL Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFG5 PE=1 SV=1 100 303 4.0E-13
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 100 303 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6I3|YHG7_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.07c PE=3 SV=2 107 310 4.0E-14
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 100 303 7.0E-14
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 94 303 1.0E-13
sp|Q5ACZ2|DFG5_CANAL Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFG5 PE=1 SV=1 100 303 4.0E-13
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 100 303 1.0E-12
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 100 303 4.0E-12
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 100 303 5.0E-12
sp|O74556|YCZ2_SCHPO Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.02 PE=3 SV=1 7 310 2.0E-10
sp|Q9P6I4|YHG6_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.06c PE=3 SV=1 142 303 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045780
MVKFLSTAFVVLAAIVAGFAQPQKRQCQATLDIALTVAQRLQSHYFNPNNGQYNGGSLWTDANTVEDLHNLMLAR
NSNEFSAVGQQSTIGRAALSNANWQSILNGSNDDAGWIVLALWKIGDYKSARGQDASPYNRAAGQIYDIIAGQWD
DTCGGGVWWSSAHTYKNAITNQLFLLTSANGFLRNRNPTYLANAQKTWNWLKASGMRNSEGLFNDGLDFNTCRNN
GQTTWTYNQGVIASGLANLYAATGDESLLDEAEITLDATIRRLSDNNILRESCDNAASGGAVCNQDQQLFKGLWT
KHLQYYLDMANDAGRTAKYASFLGSQTSAVFHFGTNADNDVGSVWYAPNQGGSIFTPKTSASGLAAHVAAAKYAP
C*
Coding >AgabiH97|045780
ATGGTCAAATTCTTGTCAACCGCTTTTGTCGTCCTTGCTGCTATCGTTGCAGGTTTTGCTCAACCGCAGAAAAGA
CAGTGTCAGGCCACGTTGGACATTGCTCTCACTGTAGCCCAAAGGCTCCAGTCCCACTACTTCAACCCCAACAAC
GGGCAGTATAATGGCGGCTCCCTCTGGACAGACGCCAATACAGTTGAAGATTTGCATAATCTCATGCTCGCCAGG
AACAGTAACGAGTTCTCGGCTGTGGGTCAGCAGTCGACCATAGGTCGAGCTGCTCTATCCAACGCAAATTGGCAG
TCTATCCTCAATGGAAGTAACGATGATGCCGGGTGGATCGTTCTTGCACTCTGGAAGATCGGTGACTACAAGAGT
GCCCGTGGCCAGGATGCTTCTCCCTACAATAGAGCTGCCGGTCAAATTTACGACATCATCGCCGGACAATGGGAT
GATACCTGCGGTGGAGGAGTCTGGTGGTCTAGCGCTCATACGTACAAAAACGCTATCACAAACCAACTTTTCCTT
CTTACTTCCGCTAACGGATTTCTACGCAATCGAAACCCTACATACCTCGCCAATGCGCAAAAGACTTGGAATTGG
CTCAAGGCTTCCGGAATGCGCAATTCTGAAGGACTCTTCAACGACGGACTCGACTTTAATACATGCCGGAATAAC
GGCCAAACCACCTGGACATATAATCAAGGTGTCATAGCGTCCGGCTTAGCCAACCTTTATGCTGCCACTGGTGAT
GAAAGCTTGCTAGATGAAGCCGAAATTACCCTGGATGCAACCATCCGGCGTCTTTCCGATAATAATATCCTCCGG
GAGTCTTGCGATAATGCTGCTTCGGGGGGTGCGGTTTGCAATCAAGACCAGCAACTCTTCAAGGGTTTGTGGACG
AAACATCTCCAGTATTATCTCGACATGGCCAATGATGCTGGACGTACAGCCAAATACGCTTCTTTCTTGGGTTCC
CAAACCTCTGCCGTTTTCCATTTCGGAACCAACGCAGACAATGATGTTGGTTCGGTGTGGTACGCACCAAACCAA
GGAGGGTCCATCTTTACTCCAAAGACAAGCGCTAGTGGTCTGGCCGCCCATGTGGCAGCCGCGAAATATGCCCCA
TGTTAG
Transcript >AgabiH97|045780
ATGGTCAAATTCTTGTCAACCGCTTTTGTCGTCCTTGCTGCTATCGTTGCAGGTTTTGCTCAACCGCAGAAAAGA
CAGTGTCAGGCCACGTTGGACATTGCTCTCACTGTAGCCCAAAGGCTCCAGTCCCACTACTTCAACCCCAACAAC
GGGCAGTATAATGGCGGCTCCCTCTGGACAGACGCCAATACAGTTGAAGATTTGCATAATCTCATGCTCGCCAGG
AACAGTAACGAGTTCTCGGCTGTGGGTCAGCAGTCGACCATAGGTCGAGCTGCTCTATCCAACGCAAATTGGCAG
TCTATCCTCAATGGAAGTAACGATGATGCCGGGTGGATCGTTCTTGCACTCTGGAAGATCGGTGACTACAAGAGT
GCCCGTGGCCAGGATGCTTCTCCCTACAATAGAGCTGCCGGTCAAATTTACGACATCATCGCCGGACAATGGGAT
GATACCTGCGGTGGAGGAGTCTGGTGGTCTAGCGCTCATACGTACAAAAACGCTATCACAAACCAACTTTTCCTT
CTTACTTCCGCTAACGGATTTCTACGCAATCGAAACCCTACATACCTCGCCAATGCGCAAAAGACTTGGAATTGG
CTCAAGGCTTCCGGAATGCGCAATTCTGAAGGACTCTTCAACGACGGACTCGACTTTAATACATGCCGGAATAAC
GGCCAAACCACCTGGACATATAATCAAGGTGTCATAGCGTCCGGCTTAGCCAACCTTTATGCTGCCACTGGTGAT
GAAAGCTTGCTAGATGAAGCCGAAATTACCCTGGATGCAACCATCCGGCGTCTTTCCGATAATAATATCCTCCGG
GAGTCTTGCGATAATGCTGCTTCGGGGGGTGCGGTTTGCAATCAAGACCAGCAACTCTTCAAGGGTTTGTGGACG
AAACATCTCCAGTATTATCTCGACATGGCCAATGATGCTGGACGTACAGCCAAATACGCTTCTTTCTTGGGTTCC
CAAACCTCTGCCGTTTTCCATTTCGGAACCAACGCAGACAATGATGTTGGTTCGGTGTGGTACGCACCAAACCAA
GGAGGGTCCATCTTTACTCCAAAGACAAGCGCTAGTGGTCTGGCCGCCCATGTGGCAGCCGCGAAATATGCCCCA
TGTTAG
Gene >AgabiH97|045780
ATGGTCAAATTCTTGTCAACCGCTTTTGTCGTCCTTGCTGCTATCGTTGCAGGTTTTGCTCAACCGCAGAAAAGA
CAGTGTCAGGCCACGTTGGACATTGCTCTCGTACGTCATACAGTATCACCATGTCAAAACTCACTCTTATCGGAT
CATACAGACTGTAGCCCAAAGGCTCCAGTCCCACTACTTCAACCCCAACAACGGGCAGTATAATGGCGGCTCCCT
CTGGACAGACGCCGTAAGTTGCATATAGACAAACATATTGTCTGATTTAATGCGGATTATTGTCCAGAATACAGT
TGAAGATTTGCATAATCTCATGCTCGCCAGGAACAGTAACGAGTTCTCGGCTGTGGGTCAGCAGTCGACCATAGG
TCGAGCTGCTCTATCCAACGCAAATTGGCAGTCTATCCTCAATGGAAGTAACGATGATGCCGGGGTCAGTTTCCA
AACTTTCCGTTCCATCATTATTATTTACCAGATTCATCAGTGGATCGTTCTTGCACTCTGGAAGATCGGTGACTA
CAAGAGTGCCCGTGGCCAGGATGCTTCTCCCTACAATGTCAAACCCTTTGATCTTGAAACACGTAGATCTCACCA
CTGACATGTGATTTTAGAGAGCTGCCGGTCAAATTTACGACATCATCGCCGGACAATGGGATGATACCTGCGGTG
GAGGAGGTAAGTTCAAGACTTCAACGCGTCAACACATTTTTAATGACGCTCATGATACCTCCCCTGTGCAGTCTG
GTGGTCTAGCGCTCATACGTACAAAAACGCTATCACAAACCAACTTTTCCTTCTTACTTCCGCTAACGGATTTCT
ACGCAATCGAAACCCTACATACCTCGCCAATGCGCAAAAGGTGAGGCTTATTGAATGTTCCGCGTCTTGTTATGG
ACCATATACTCATCAATCCCTCTGTTACGGATCATAGACTTGGAATTGGCGTCAGTATCATTTTAATAAGCTTCA
AGGTGAAACACTAATTAAGATTGTCCATACAGTCAAGGCTTCCGGAATGCGCAATTCTGAAGGACTCTTCAACGA
CGGACTCGACTTTAATACATGCCGGAATAACGGCCAAGTGCGCAACCACCAATATCACTATAGTTTTAATATTGA
TCACTCCCCGATGATTTAGACCACCTGGACATATAATCAAGGTGTCATAGCGTCCGGCTTAGCCAACCTTTATGC
TGCCACTGGTGATGAAAGCTTGCTAGATGAAGCCGAAATTACCCTGGATGCAACCATCCGGCGTCTTTCCGATAA
TAATATCCTCCGGGAGTCTTGCGATAATGCTGCTTCGGGGGGTGCGGTTTGCAATCAAGACCAGGTATGCTTCAC
CAGCTCATGAGACTGTTGGTCACTCTCTGACAGTTTTCCATGTTAGCAACTCTTCAAGGGTTTGTGGACGAAACA
TCTCCAGTATTATCTCGACATGGCCAATGATGCTGGACGTACAGCCAAATACGCTTCTTTCTTGGGTTCCCAAAC
CTCTGCCGTTTTCCATTTCGGAACCAACGCAGACAATGATGTTGGTTCGGTGTGGTACGCACCAAACCAAGGAGG
GTCCATCTTTACTCCAAAGACAAGCGCTAGTGGTCTGGCCGCCCATGTGGCAGCCGCGAAATATGCCCCATGTTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail