Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045630
Gene name
Locationscaffold_2:1747411..1751986
Strand-
Gene length (bp)4575
Transcript length (bp)3981
Coding sequence length (bp)3981
Protein length (aa) 1327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 3.2E-43 1145 1295
PF00412 LIM LIM domain 8.2E-07 36 94
PF00412 LIM LIM domain 6.0E-07 96 150
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 5.7E-07 1062 1110

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 1075 1322 3.0E-37
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 1075 1322 4.0E-37
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 1075 1322 2.0E-36
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 1075 1322 1.0E-35
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 897 1322 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 1075 1322 3.0E-37
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 1075 1322 4.0E-37
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 1075 1322 2.0E-36
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 1075 1322 1.0E-35
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 897 1322 3.0E-35
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 1075 1322 5.0E-35
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 1075 1322 7.0E-35
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 1075 1322 1.0E-34
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 836 1322 3.0E-34
sp|Q5PQJ5|RHG29_RAT Rho GTPase-activating protein 29 OS=Rattus norvegicus GN=Arhgap29 PE=1 SV=2 1056 1325 1.0E-30
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 1144 1316 4.0E-30
sp|Q8CGF1|RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus GN=Arhgap29 PE=1 SV=1 1046 1325 8.0E-30
sp|Q52LW3|RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens GN=ARHGAP29 PE=1 SV=2 1056 1325 2.0E-29
sp|A7YY57|RHG29_BOVIN Rho GTPase-activating protein 29 OS=Bos taurus GN=ARHGAP29 PE=2 SV=1 1056 1325 2.0E-29
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 1059 1315 2.0E-29
sp|Q6PCS4|RHG29_DANRE Rho GTPase-activating protein 29 OS=Danio rerio GN=arhgap29 PE=2 SV=1 1042 1322 2.0E-29
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 1059 1315 3.0E-29
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 1059 1315 3.0E-29
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 1059 1322 2.0E-28
sp|Q6PGG2|GMIP_MOUSE GEM-interacting protein OS=Mus musculus GN=Gmip PE=1 SV=1 1074 1322 2.0E-27
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 1141 1323 3.0E-27
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 1144 1316 5.0E-27
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 1059 1322 8.0E-27
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 1143 1316 8.0E-27
sp|Q9P107|GMIP_HUMAN GEM-interacting protein OS=Homo sapiens GN=GMIP PE=1 SV=2 1074 1322 1.0E-26
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 1144 1316 2.0E-26
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 1124 1326 2.0E-26
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 1141 1323 2.0E-26
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 1059 1322 2.0E-26
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 1140 1323 3.0E-26
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 1140 1294 3.0E-26
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 1140 1323 3.0E-26
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 1140 1294 5.0E-26
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 1144 1310 7.0E-26
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 1123 1326 1.0E-25
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 1143 1322 2.0E-25
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 1144 1310 2.0E-25
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 1140 1294 3.0E-25
sp|Q640N3|RHG30_MOUSE Rho GTPase-activating protein 30 OS=Mus musculus GN=Arhgap30 PE=1 SV=3 1124 1324 5.0E-25
sp|Q9VIS1|CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster GN=CdGAPr PE=1 SV=2 1124 1322 1.0E-24
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 1144 1323 2.0E-24
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 1123 1326 4.0E-24
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 1144 1323 5.0E-24
sp|Q6DE55|HMHA1_XENLA Minor histocompatibility protein HA-1 OS=Xenopus laevis GN=hmha1 PE=2 SV=1 1073 1322 4.0E-23
sp|P98171|RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens GN=ARHGAP4 PE=1 SV=2 1106 1322 2.0E-22
sp|Q6ZQ82|RHG26_MOUSE Rho GTPase-activating protein 26 OS=Mus musculus GN=Arhgap26 PE=1 SV=3 1147 1322 2.0E-22
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 1124 1323 2.0E-22
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 1124 1294 2.0E-22
sp|B5DFQ4|RHG26_XENTR Rho GTPase-activating protein 26 OS=Xenopus tropicalis GN=arhgap26 PE=2 SV=1 1147 1323 3.0E-22
sp|Q5ZMW5|RHG26_CHICK Rho GTPase-activating protein 26 OS=Gallus gallus GN=ARHGAP26 PE=1 SV=2 1147 1322 3.0E-22
sp|Q9UNA1|RHG26_HUMAN Rho GTPase-activating protein 26 OS=Homo sapiens GN=ARHGAP26 PE=1 SV=1 1147 1322 3.0E-22
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 1124 1324 4.0E-22
sp|Q9BE31|RHG12_MACFA Rho GTPase-activating protein 12 OS=Macaca fascicularis GN=ARHGAP12 PE=2 SV=1 1124 1316 4.0E-22
sp|Q6ZM89|RH42A_DANRE Rho GTPase-activating protein 42 OS=Danio rerio GN=arhgap42a PE=2 SV=3 1147 1325 4.0E-22
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 1124 1324 5.0E-22
sp|Q8IWW6|RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens GN=ARHGAP12 PE=1 SV=1 1124 1316 8.0E-22
sp|Q5RB40|HMHA1_PONAB Minor histocompatibility protein HA-1 OS=Pongo abelii GN=HMHA1 PE=2 SV=1 1074 1322 8.0E-22
sp|Q92619|HMHA1_HUMAN Minor histocompatibility protein HA-1 OS=Homo sapiens GN=HMHA1 PE=1 SV=2 1074 1322 9.0E-22
sp|Q8C0D4|RHG12_MOUSE Rho GTPase-activating protein 12 OS=Mus musculus GN=Arhgap12 PE=1 SV=2 1124 1316 9.0E-22
sp|Q3TBD2|HMHA1_MOUSE Minor histocompatibility protein HA-1 OS=Mus musculus GN=Hmha1 PE=1 SV=2 1074 1322 1.0E-21
sp|Q9WVM1|RGAP1_MOUSE Rac GTPase-activating protein 1 OS=Mus musculus GN=Racgap1 PE=1 SV=1 1054 1315 1.0E-21
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 1125 1322 1.0E-21
sp|Q5U2Z7|RHG24_RAT Rho GTPase-activating protein 24 OS=Rattus norvegicus GN=Arhgap24 PE=1 SV=2 1118 1293 3.0E-21
sp|Q5U4T3|RHG26_XENLA Rho GTPase-activating protein 26 OS=Xenopus laevis GN=arhgap26 PE=2 SV=1 1147 1323 3.0E-21
sp|P81128|RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus GN=Arhgap35 PE=1 SV=2 1141 1322 3.0E-21
sp|Q91YM2|RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus GN=Arhgap35 PE=1 SV=3 1141 1322 5.0E-21
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 1125 1322 5.0E-21
sp|Q8C4V1|RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus GN=Arhgap24 PE=1 SV=2 1118 1293 6.0E-21
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 1141 1322 6.0E-21
sp|A6QNS3|ABR_BOVIN Active breakpoint cluster region-related protein OS=Bos taurus GN=ABR PE=2 SV=1 1143 1293 9.0E-21
sp|P0CAX5|OPHN1_RAT Oligophrenin-1 OS=Rattus norvegicus GN=Ophn1 PE=1 SV=1 1147 1324 1.0E-20
sp|Q12979|ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens GN=ABR PE=2 SV=2 1143 1293 1.0E-20
sp|Q8N264|RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens GN=ARHGAP24 PE=1 SV=2 1118 1293 1.0E-20
sp|O43295|SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens GN=SRGAP3 PE=1 SV=3 1119 1296 1.0E-20
sp|Q06407|RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGA2 PE=1 SV=1 1158 1325 1.0E-20
sp|Q5SSL4|ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus GN=Abr PE=1 SV=1 1143 1293 1.0E-20
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 1118 1293 1.0E-20
sp|Q9NRY4|RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens GN=ARHGAP35 PE=1 SV=3 1141 1322 2.0E-20
sp|Q7Z6B7|SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens GN=SRGAP1 PE=1 SV=1 1144 1325 2.0E-20
sp|Q99J31|OPHN1_MOUSE Oligophrenin-1 OS=Mus musculus GN=Ophn1 PE=1 SV=1 1147 1324 2.0E-20
sp|P83509|RHG35_CANLF Rho GTPase-activating protein 35 OS=Canis lupus familiaris GN=ARHGAP35 PE=2 SV=1 1141 1322 2.0E-20
sp|Q7YQL5|OPHN1_PONPY Oligophrenin-1 OS=Pongo pygmaeus GN=OPHN1 PE=2 SV=1 1147 1324 3.0E-20
sp|Q7YQL6|OPHN1_PANTR Oligophrenin-1 OS=Pan troglodytes GN=OPHN1 PE=2 SV=1 1147 1324 3.0E-20
sp|O60890|OPHN1_HUMAN Oligophrenin-1 OS=Homo sapiens GN=OPHN1 PE=1 SV=1 1147 1324 3.0E-20
sp|B0S6J3|SRGP2_DANRE SLIT-ROBO Rho GTPase-activating protein 2 OS=Danio rerio GN=srgap2 PE=2 SV=1 1144 1324 5.0E-20
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 1124 1324 5.0E-20
sp|Q91Z69|SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus GN=Srgap1 PE=1 SV=2 1144 1325 5.0E-20
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 1118 1293 6.0E-20
sp|Q812A2|SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus GN=Srgap3 PE=1 SV=1 1119 1296 6.0E-20
sp|A4II46|ABR_XENTR Active breakpoint cluster region-related protein OS=Xenopus tropicalis GN=abr PE=2 SV=1 1143 1293 7.0E-20
sp|Q8AVG0|ABR_XENLA Active breakpoint cluster region-related protein OS=Xenopus laevis GN=abr PE=2 SV=1 1143 1293 1.0E-19
sp|P39083|RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGA1 PE=1 SV=1 36 164 2.0E-19
sp|Q9Y3L3|3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens GN=SH3BP1 PE=1 SV=3 1097 1324 2.0E-19
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 1147 1325 2.0E-19
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 1054 1315 2.0E-19
sp|P97393|RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus GN=Arhgap5 PE=1 SV=2 1141 1301 2.0E-19
sp|B2RQE8|RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus GN=Arhgap42 PE=1 SV=1 1147 1325 3.0E-19
sp|Q5VT97|SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens GN=SYDE2 PE=1 SV=2 1122 1292 5.0E-19
sp|Q559A0|GACU_DICDI Rho GTPase-activating protein gacU OS=Dictyostelium discoideum GN=gacU PE=3 SV=1 1144 1293 5.0E-19
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 1143 1293 6.0E-19
sp|Q9V9S7|SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster GN=RhoGAP100F PE=1 SV=2 1122 1316 8.0E-19
sp|Q20498|RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans GN=rrc-1 PE=1 SV=3 1124 1295 9.0E-19
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 1143 1293 9.0E-19
sp|Q13017|RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens GN=ARHGAP5 PE=1 SV=2 1141 1301 9.0E-19
sp|Q06407|RGA2_YEAST Rho-type GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGA2 PE=1 SV=1 35 147 1.0E-18
sp|P39083|RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGA1 PE=1 SV=1 1123 1323 2.0E-18
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 1123 1321 2.0E-18
sp|O94466|RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga7 PE=1 SV=1 1144 1322 2.0E-18
sp|O14014|RGA3_SCHPO Probable Rho-type GTPase-activating protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga3 PE=1 SV=1 52 150 3.0E-18
sp|Q8BYW1|RHG25_MOUSE Rho GTPase-activating protein 25 OS=Mus musculus GN=Arhgap25 PE=1 SV=2 1123 1294 3.0E-18
sp|Q10164|RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga2 PE=1 SV=1 1124 1291 4.0E-18
sp|P42331|RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens GN=ARHGAP25 PE=1 SV=2 1121 1294 8.0E-18
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 1125 1322 9.0E-18
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 1144 1322 1.0E-17
sp|P55194|3BP1_MOUSE SH3 domain-binding protein 1 OS=Mus musculus GN=Sh3bp1 PE=1 SV=2 1142 1324 2.0E-17
sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens GN=SRGAP2 PE=1 SV=2 1144 1322 3.0E-17
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 1144 1322 3.0E-17
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 1125 1324 3.0E-17
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 1144 1322 4.0E-17
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 1121 1296 4.0E-17
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 1125 1324 5.0E-17
sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens GN=ARHGAP1 PE=1 SV=1 1144 1322 7.0E-17
sp|Q5FWK3|RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus GN=Arhgap1 PE=1 SV=1 1130 1322 2.0E-16
sp|Q54WY8|GACN_DICDI Rho GTPase-activating protein gacN OS=Dictyostelium discoideum GN=gacN PE=3 SV=1 1148 1300 5.0E-16
sp|Q9CXP4|RHG08_MOUSE Rho GTPase-activating protein 8 OS=Mus musculus GN=Arhgap8 PE=2 SV=3 1144 1323 5.0E-16
sp|O94988|FA13A_HUMAN Protein FAM13A OS=Homo sapiens GN=FAM13A PE=1 SV=2 1144 1300 7.0E-16
sp|Q54MV3|GACJ_DICDI Rho GTPase-activating protein gacJ OS=Dictyostelium discoideum GN=gacJ PE=3 SV=1 1144 1326 8.0E-16
sp|Q86IG9|GACH_DICDI Rho GTPase-activating protein gacH OS=Dictyostelium discoideum GN=gacH PE=3 SV=1 1129 1295 1.0E-15
sp|P85298|RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens GN=ARHGAP8 PE=1 SV=1 1144 1323 3.0E-15
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 1125 1324 5.0E-15
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 1141 1294 7.0E-15
sp|Q6ZW31|SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens GN=SYDE1 PE=1 SV=1 1122 1292 9.0E-15
sp|Q9BRR9|RHG09_HUMAN Rho GTPase-activating protein 9 OS=Homo sapiens GN=ARHGAP9 PE=1 SV=2 1124 1316 9.0E-15
sp|Q9VDS5|RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster GN=RhoGAP92B PE=1 SV=1 1123 1292 1.0E-14
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 1125 1324 1.0E-14
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 1141 1294 2.0E-14
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 1125 1324 3.0E-14
sp|P39960|BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM2 PE=1 SV=1 1144 1302 4.0E-14
sp|Q9DBZ9|SYDE1_MOUSE Rho GTPase-activating protein SYDE1 OS=Mus musculus GN=Syde1 PE=1 SV=1 1122 1292 7.0E-14
sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BEM2 PE=3 SV=1 1144 1323 9.0E-14
sp|Q15311|RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens GN=RALBP1 PE=1 SV=3 1116 1291 9.0E-14
sp|Q9VX32|RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster GN=RhoGAPp190 PE=1 SV=2 1125 1324 9.0E-14
sp|Q9PT60|RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis GN=ralbp1-a PE=1 SV=3 1124 1291 7.0E-13
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 1132 1294 7.0E-13
sp|Q54TH9|GACY_DICDI Rho GTPase-activating protein gacY OS=Dictyostelium discoideum GN=gacY PE=3 SV=1 1143 1316 8.0E-13
sp|A8WRJ2|RRC1_CAEBR GTPase-activating protein rrc-1 OS=Caenorhabditis briggsae GN=rrc-1 PE=3 SV=2 1124 1295 9.0E-13
sp|Q62172|RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus GN=Ralbp1 PE=1 SV=4 1118 1291 1.0E-12
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 1132 1294 1.0E-12
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 1144 1322 1.0E-12
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 1143 1292 2.0E-12
sp|Q8SSN9|GACF_DICDI Rho GTPase-activating protein gacF OS=Dictyostelium discoideum GN=gacF PE=3 SV=2 1140 1322 3.0E-12
sp|Q8WZ64|ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ARAP2 PE=1 SV=3 1144 1322 5.0E-12
sp|Q9P2F6|RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens GN=ARHGAP20 PE=1 SV=2 1116 1322 7.0E-12
sp|Q6REY9|RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus GN=Arhgap20 PE=1 SV=2 1116 1322 7.0E-12
sp|Q62796|RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus GN=Ralbp1 PE=1 SV=3 1124 1291 1.0E-11
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 1142 1292 3.0E-11
sp|Q6IFT4|RHG20_MOUSE Rho GTPase-activating protein 20 OS=Mus musculus GN=Arhgap20 PE=1 SV=1 1116 1322 3.0E-11
sp|Q8BZ05|ARAP2_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Arap2 PE=1 SV=2 1144 1322 4.0E-11
sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 1121 1296 6.0E-11
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 1142 1292 7.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 1147 1323 9.0E-11
sp|P40809|RG84C_DROME GTPase-activating protein RacGAP84C OS=Drosophila melanogaster GN=RacGAP84C PE=2 SV=1 1061 1315 1.0E-10
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 1118 1308 2.0E-10
sp|Q54G18|GACW_DICDI Rho GTPase-activating protein gacW OS=Dictyostelium discoideum GN=gacW PE=3 SV=1 1129 1294 2.0E-10
sp|Q55DS4|LIMG_DICDI LIM domain-containing protein G OS=Dictyostelium discoideum GN=limG PE=3 SV=1 35 146 5.0E-10
sp|Q9U3F4|ZYX_CAEEL Zyxin OS=Caenorhabditis elegans GN=zyx-1 PE=1 SV=1 31 151 8.0E-10
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 1123 1292 1.0E-09
sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating protein OS=Homo sapiens GN=TAGAP PE=1 SV=1 1139 1322 5.0E-09
sp|Q8K0Q5|RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus GN=Arhgap18 PE=1 SV=1 1129 1292 5.0E-09
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 36 153 6.0E-09
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 36 144 8.0E-09
sp|Q54J98|GACX_DICDI Rho GTPase-activating protein gacX OS=Dictyostelium discoideum GN=gacX PE=3 SV=1 1140 1322 8.0E-09
sp|Q54YV1|GACII_DICDI Rho GTPase-activating protein gacII OS=Dictyostelium discoideum GN=gacII PE=3 SV=1 1146 1293 1.0E-08
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 1141 1293 1.0E-08
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 36 153 2.0E-08
sp|Q8N392|RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens GN=ARHGAP18 PE=1 SV=3 1129 1292 2.0E-08
sp|Q9VDG2|RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster GN=Rlip PE=1 SV=1 1144 1291 3.0E-08
sp|B1AUC7|RHG36_MOUSE Rho GTPase-activating protein 36 OS=Mus musculus GN=Arhgap36 PE=2 SV=1 1142 1293 3.0E-08
sp|Q5R685|P85A_PONAB Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Pongo abelii GN=PIK3R1 PE=2 SV=1 1145 1293 4.0E-08
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 36 144 4.0E-08
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 1123 1292 6.0E-08
sp|E9Q6X9|RHG40_MOUSE Rho GTPase-activating protein 40 OS=Mus musculus GN=Arhgap40 PE=3 SV=1 1143 1292 6.0E-08
sp|Q923Q2|STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus GN=Stard13 PE=1 SV=5 1123 1292 7.0E-08
sp|Q54XE8|GACP_DICDI Rho GTPase-activating protein gacP OS=Dictyostelium discoideum GN=gacP PE=3 SV=1 1125 1324 7.0E-08
sp|Q8UUU2|P85AA_XENLA Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Xenopus laevis GN=pik3r1-a PE=2 SV=1 1145 1293 8.0E-08
sp|P23727|P85A_BOVIN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Bos taurus GN=PIK3R1 PE=1 SV=1 1145 1300 9.0E-08
sp|Q54BF1|GACE_DICDI Rho GTPase-activating protein gacE OS=Dictyostelium discoideum GN=gacE PE=3 SV=1 1147 1322 9.0E-08
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 1123 1292 1.0E-07
sp|P27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Homo sapiens GN=PIK3R1 PE=1 SV=2 1145 1293 1.0E-07
sp|P26450|P85A_MOUSE Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Mus musculus GN=Pik3r1 PE=1 SV=2 1145 1295 1.0E-07
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 1123 1292 2.0E-07
sp|B9VTT2|RHG07_CANLF Rho GTPase-activating protein 7 OS=Canis lupus familiaris GN=DLC1 PE=2 SV=1 1123 1292 3.0E-07
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 3 144 3.0E-07
sp|Q9WTX7|FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus GN=Fhl5 PE=1 SV=1 17 148 3.0E-07
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 36 153 4.0E-07
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 31 146 4.0E-07
sp|Q12128|BAG7_YEAST Rho-GTPase-activating protein BAG7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAG7 PE=1 SV=1 1144 1295 5.0E-07
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 36 144 8.0E-07
sp|Q8IR79|LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster GN=LIMK1 PE=1 SV=1 35 150 9.0E-07
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 36 144 9.0E-07
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 36 144 9.0E-07
sp|Q63787|P85A_RAT Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Rattus norvegicus GN=Pik3r1 PE=1 SV=1 1145 1295 9.0E-07
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 36 170 1.0E-06
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 31 146 1.0E-06
sp|Q6ZRI8|RHG36_HUMAN Rho GTPase-activating protein 36 OS=Homo sapiens GN=ARHGAP36 PE=2 SV=1 1142 1293 1.0E-06
sp|Q6AXT1|FHL5_RAT Four and a half LIM domains protein 5 OS=Rattus norvegicus GN=Fhl5 PE=2 SV=1 17 148 1.0E-06
sp|Q9Y3M8|STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens GN=STARD13 PE=1 SV=2 1123 1292 2.0E-06
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 32 153 3.0E-06
sp|P53666|LIMK2_CHICK LIM domain kinase 2 OS=Gallus gallus GN=LIMK2 PE=2 SV=1 36 152 3.0E-06
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 32 153 4.0E-06
sp|Q54XT6|GACR_DICDI Rho GTPase-activating protein gacR OS=Dictyostelium discoideum GN=gacR PE=3 SV=1 1144 1292 4.0E-06
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 1142 1312 5.0E-06
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 51 134 5.0E-06
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 36 131 5.0E-06
sp|P53670|LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus GN=Limk2 PE=2 SV=1 59 152 7.0E-06
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 36 146 7.0E-06
sp|D2H9U0|RHG36_AILME Rho GTPase-activating protein 36 OS=Ailuropoda melanoleuca GN=ARHGAP36 PE=3 SV=1 1142 1293 8.0E-06
sp|O54785|LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus GN=Limk2 PE=1 SV=2 59 152 8.0E-06
sp|Q86NH1|SYD1_CAEEL Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans GN=syd-1 PE=2 SV=1 1142 1292 8.0E-06
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 37 154 8.0E-06
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 27 164 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045630
MLASMASPTLAAPLHEQSHVEVPHITRDLGLDERICPGCKKSAVSEEGGLVVAFGQSFFHVDCFKCAKCGNHVTA
DTNLLLLSDGSPICANCSYSCNVCHLPILDEAIMTGDDSYHAHCFKCKVCKNRIDELVFAKTSQGIYCMSCHNER
MIKIRKYTQKKAERERNAGGESGRARDRDARNYIRDASPGYDSISRPSSSKSTGNLAAAARQDMSRPSTARSTES
SAYTRPIVKPKGPPQVYNGQDSRSATSQSASHQNTTTPIPSPSFSPTPVTNEHSTVNQKSHHDVSPTLNVNLTPT
SLEPNAKRRSYDDGVRPLQILFGQKQATSGNTTLRPDTKAAASGSLTVTSRQQKRRSINPGLVLPNISMALPSGL
NTRLSPVSSTSSDFQSARSTNPVGSEAGQEQVSRPTSQDASTHSHDPSRETTSKGWEHSSSTVARDNGDQRLVLK
HLESPSPSLSPAIRLATSQADDASSRLSSTSNFSGEERGLAVGSRSNSPYRQIDVPRSIENGSDSDEAGELASPL
PDQRHSLPTSSRSENGESKETQSPVLSEDYSALSQETSDDMSESSPVERLSHATFIAPALPPIRFSLNAADFSEL
LSSVQGSSALKSLDQMASLLQESDNASAPLKASSGKTMTTVTKSSATTANGHQTGKTGEHTTPNSRPSGISGKNS
PENKPLPNPNLLSDRESLSSESLDPSKDPRVTVTSAGSEETSTRHDMTDSVVTRLRRVLKDSRDHGLQHINLEID
FAVAVLETLDSRKMVYEDLKEKFDGVKRTSRNLTEGVSAAQAEYDKEQKARRDAEAEVTRLRVLLSGQAAKLMAM
SGDDRRQELRQQISKELNDNLSGLEQDLSRLKLERDIALAEVEELSSTKSLASNEKSSVNLGRSVTKRLDGLRRQ
YQRDLIPLTEERERLGREIAELKAIRDTFLEETTALNARNEELAQLSHIYSRRLEAIPEAPLKQGHVNNASRPSF
ERPKNPGHTTTQSVLPLAPSLSASTSGSSTTTVQDEYDRHMKHPSRSDSDFSSTPRRLKWIGYNKGKTAASSAAA
QDAQRSKGHLEHTFQQISVLRFTRCDHCAEKLWGSQLRCSVCNISIHVRCVAAVQTSCAQRHGDDPQAPLPPSMF
GRDLIEQAQYDGRGDDRQVPILVEKCVQAVEAIALDYEGIYRKTGGSSQSKMIAQLFERGDYTTFDLLDTDRFND
ICSVTSVLKTYFRSLPNPLLTFALYKSFVEAISIKDIAIRDKTLSDLVKQLPSEHYYTLRVLMIHLHHVHQRNDT
NLMNARNLGVVFGPTLIRSPDPGAEFGDMAQRALFIEWLVENAPRVFTGAA*
Coding >AgabiH97|045630
ATGCTCGCTTCCATGGCCTCCCCCACACTCGCCGCTCCCCTCCACGAACAGTCCCACGTCGAGGTACCCCACATC
ACGCGCGATCTCGGTCTTGACGAGAGAATATGTCCGGGGTGTAAAAAATCCGCCGTGAGCGAAGAAGGCGGCCTT
GTCGTAGCCTTCGGTCAATCATTCTTCCATGTCGACTGCTTCAAGTGCGCCAAATGCGGCAACCATGTCACCGCA
GATACCAACCTTCTACTACTGTCCGATGGTTCCCCCATATGCGCCAACTGCTCCTACAGCTGCAACGTCTGTCAC
CTTCCCATCCTCGACGAAGCCATCATGACTGGCGACGATTCTTATCATGCACACTGCTTCAAATGTAAAGTATGC
AAGAACAGGATCGATGAGCTTGTCTTCGCCAAGACCAGCCAGGGCATCTATTGTATGAGCTGTCACAATGAGCGT
ATGATCAAAATAAGGAAGTATACTCAGAAAAAGGCTGAACGCGAACGCAATGCTGGCGGTGAATCCGGTAGGGCA
CGGGATCGAGACGCTCGAAATTACATCCGAGATGCTTCTCCGGGTTACGACTCAATTTCCCGTCCGTCGTCGTCC
AAGTCCACGGGGAATCTGGCAGCGGCTGCGCGGCAAGATATGTCTCGACCCAGTACGGCGCGCAGCACCGAAAGT
TCGGCATATACCCGGCCAATCGTCAAACCCAAAGGTCCACCACAAGTTTACAATGGACAAGATAGTCGGAGCGCG
ACTTCGCAATCTGCCTCCCATCAGAATACGACTACACCTATTCCCTCGCCCTCTTTTTCCCCGACTCCTGTCACC
AATGAACACTCGACCGTAAATCAAAAGTCTCATCACGACGTATCCCCTACACTTAACGTAAACCTTACACCCACG
AGTTTGGAACCCAACGCTAAACGTCGAAGCTATGATGACGGAGTTCGTCCTTTACAAATTCTCTTTGGCCAAAAG
CAAGCTACGTCAGGTAACACTACCCTTCGACCGGACACAAAAGCAGCTGCTTCGGGAAGTCTGACGGTCACTTCG
CGACAGCAGAAGCGTCGTTCCATCAATCCTGGCTTGGTCCTTCCTAATATCAGCATGGCACTTCCATCCGGACTA
AACACCAGGCTGTCTCCCGTCTCATCTACATCCTCAGATTTCCAGTCAGCTCGTTCTACGAATCCAGTGGGTTCA
GAAGCTGGACAAGAGCAGGTTTCTCGACCTACATCTCAAGACGCTTCTACCCATAGTCATGATCCTTCCCGGGAA
ACAACAAGCAAAGGATGGGAGCACTCGTCTTCCACAGTCGCTCGAGATAATGGGGATCAGAGATTGGTACTCAAA
CATTTAGAATCTCCATCTCCATCTCTGAGTCCGGCTATCCGATTAGCAACGAGTCAAGCCGACGATGCCAGCAGT
AGGCTGTCGTCAACATCAAATTTCAGTGGTGAAGAAAGAGGATTGGCTGTGGGCTCTAGATCCAATTCACCGTAT
CGTCAGATAGACGTGCCACGAAGCATAGAGAATGGATCAGATTCGGATGAAGCTGGAGAACTTGCGAGTCCTCTC
CCTGATCAGCGTCATTCACTTCCCACATCGTCTCGCTCGGAGAATGGCGAATCTAAGGAAACGCAATCGCCTGTT
TTGAGTGAGGATTATTCTGCCTTGTCTCAGGAAACTTCGGATGACATGTCGGAATCGTCACCTGTCGAACGTCTT
TCGCATGCAACTTTCATTGCCCCTGCGCTCCCCCCCATCCGATTTTCCTTAAACGCGGCAGATTTCAGTGAATTG
TTGAGCTCCGTCCAAGGTTCTTCCGCGCTGAAGTCTCTTGACCAAATGGCATCTCTCTTACAAGAATCTGACAAT
GCCTCTGCGCCCCTCAAAGCCTCTTCTGGAAAGACCATGACCACGGTCACCAAATCTTCGGCCACCACAGCGAAT
GGGCACCAAACCGGCAAAACGGGGGAACATACTACCCCTAATAGCAGACCCTCCGGAATCAGTGGAAAAAATTCG
CCAGAAAACAAGCCGCTGCCGAATCCGAATCTTCTTTCTGATCGTGAATCATTGAGTAGTGAATCTCTGGATCCA
TCTAAAGATCCTCGTGTAACGGTGACTTCCGCTGGCTCGGAAGAAACATCGACGCGACATGACATGACAGATTCT
GTTGTTACGCGATTACGAAGAGTGCTCAAAGATTCACGAGACCACGGTTTGCAGCACATCAATCTGGAGATCGAT
TTTGCGGTAGCAGTACTCGAGACACTGGACTCCCGCAAGATGGTTTACGAGGATTTGAAAGAAAAATTCGATGGA
GTCAAGAGAACAAGCAGGAACCTCACTGAGGGTGTATCCGCTGCGCAGGCTGAATATGACAAGGAACAAAAGGCA
AGGCGTGATGCGGAAGCAGAAGTCACTCGGTTGCGGGTTCTGCTCTCTGGCCAAGCGGCCAAGCTGATGGCAATG
TCTGGTGACGATCGGCGCCAGGAACTCAGGCAACAGATATCCAAAGAATTGAATGACAATCTGTCTGGCCTTGAA
CAAGACCTCTCGAGGTTGAAGCTAGAACGGGACATTGCGCTGGCAGAGGTGGAAGAGCTCTCATCAACCAAGAGT
CTAGCATCCAATGAGAAATCCTCGGTGAATCTTGGAAGATCCGTTACAAAACGTCTGGACGGTTTAAGGAGACAA
TACCAAAGGGATCTGATTCCACTTACCGAGGAAAGAGAAAGGCTTGGTCGGGAGATTGCCGAACTCAAAGCAATC
CGTGACACATTTCTTGAGGAGACAACTGCCCTTAATGCCCGTAATGAGGAGCTTGCTCAACTGAGTCATATATAT
TCTCGCCGATTGGAAGCGATTCCGGAAGCTCCACTCAAGCAAGGACATGTCAACAATGCATCTCGTCCTTCATTC
GAAAGACCTAAAAATCCTGGCCATACTACAACCCAGTCGGTTCTCCCTCTTGCGCCTTCTCTTAGTGCTTCCACA
AGTGGATCGTCCACAACCACTGTCCAAGACGAATATGACAGGCATATGAAGCATCCGTCTAGATCAGATTCAGAT
TTCTCCTCTACACCTCGTAGATTGAAATGGATAGGATACAATAAAGGAAAAACAGCAGCCTCGTCAGCGGCGGCA
CAAGACGCCCAGAGAAGCAAGGGCCATTTAGAGCATACTTTCCAGCAGATCAGCGTATTACGTTTCACTCGATGT
GACCATTGCGCAGAAAAATTATGGGGCTCTCAATTGCGTTGTTCGGTTTGCAACATCTCAATCCACGTTCGCTGC
GTGGCTGCTGTTCAAACGTCTTGTGCGCAGCGGCACGGGGATGACCCTCAAGCTCCTTTACCTCCTTCGATGTTC
GGCCGGGACTTGATTGAGCAAGCGCAATATGACGGTCGGGGTGATGATCGACAAGTTCCCATCCTCGTTGAAAAA
TGTGTTCAGGCTGTTGAGGCGATTGCGCTCGATTATGAAGGTATCTACCGCAAGACGGGTGGTTCAAGCCAATCG
AAGATGATTGCCCAATTGTTTGAACGCGGAGATTATACAACATTCGACTTGCTTGACACCGACAGATTTAATGAT
ATCTGCAGCGTCACATCGGTTTTGAAAACCTATTTCCGCTCATTACCCAACCCACTCCTTACATTTGCCCTATAC
AAGTCATTCGTGGAAGCTATTTCCATTAAGGACATTGCGATCAGGGACAAGACATTATCCGATCTCGTTAAGCAG
CTACCCAGTGAGCATTACTATACACTGCGTGTATTGATGATACACCTTCACCATGTACATCAACGGAACGATACG
AACTTGATGAATGCAAGGAACCTGGGAGTGGTTTTCGGACCGACCCTCATCAGGTCCCCTGATCCTGGCGCTGAA
TTCGGCGACATGGCCCAGAGAGCCCTCTTTATTGAATGGCTCGTTGAAAATGCTCCTCGAGTATTCACCGGAGCT
GCATAG
Transcript >AgabiH97|045630
ATGCTCGCTTCCATGGCCTCCCCCACACTCGCCGCTCCCCTCCACGAACAGTCCCACGTCGAGGTACCCCACATC
ACGCGCGATCTCGGTCTTGACGAGAGAATATGTCCGGGGTGTAAAAAATCCGCCGTGAGCGAAGAAGGCGGCCTT
GTCGTAGCCTTCGGTCAATCATTCTTCCATGTCGACTGCTTCAAGTGCGCCAAATGCGGCAACCATGTCACCGCA
GATACCAACCTTCTACTACTGTCCGATGGTTCCCCCATATGCGCCAACTGCTCCTACAGCTGCAACGTCTGTCAC
CTTCCCATCCTCGACGAAGCCATCATGACTGGCGACGATTCTTATCATGCACACTGCTTCAAATGTAAAGTATGC
AAGAACAGGATCGATGAGCTTGTCTTCGCCAAGACCAGCCAGGGCATCTATTGTATGAGCTGTCACAATGAGCGT
ATGATCAAAATAAGGAAGTATACTCAGAAAAAGGCTGAACGCGAACGCAATGCTGGCGGTGAATCCGGTAGGGCA
CGGGATCGAGACGCTCGAAATTACATCCGAGATGCTTCTCCGGGTTACGACTCAATTTCCCGTCCGTCGTCGTCC
AAGTCCACGGGGAATCTGGCAGCGGCTGCGCGGCAAGATATGTCTCGACCCAGTACGGCGCGCAGCACCGAAAGT
TCGGCATATACCCGGCCAATCGTCAAACCCAAAGGTCCACCACAAGTTTACAATGGACAAGATAGTCGGAGCGCG
ACTTCGCAATCTGCCTCCCATCAGAATACGACTACACCTATTCCCTCGCCCTCTTTTTCCCCGACTCCTGTCACC
AATGAACACTCGACCGTAAATCAAAAGTCTCATCACGACGTATCCCCTACACTTAACGTAAACCTTACACCCACG
AGTTTGGAACCCAACGCTAAACGTCGAAGCTATGATGACGGAGTTCGTCCTTTACAAATTCTCTTTGGCCAAAAG
CAAGCTACGTCAGGTAACACTACCCTTCGACCGGACACAAAAGCAGCTGCTTCGGGAAGTCTGACGGTCACTTCG
CGACAGCAGAAGCGTCGTTCCATCAATCCTGGCTTGGTCCTTCCTAATATCAGCATGGCACTTCCATCCGGACTA
AACACCAGGCTGTCTCCCGTCTCATCTACATCCTCAGATTTCCAGTCAGCTCGTTCTACGAATCCAGTGGGTTCA
GAAGCTGGACAAGAGCAGGTTTCTCGACCTACATCTCAAGACGCTTCTACCCATAGTCATGATCCTTCCCGGGAA
ACAACAAGCAAAGGATGGGAGCACTCGTCTTCCACAGTCGCTCGAGATAATGGGGATCAGAGATTGGTACTCAAA
CATTTAGAATCTCCATCTCCATCTCTGAGTCCGGCTATCCGATTAGCAACGAGTCAAGCCGACGATGCCAGCAGT
AGGCTGTCGTCAACATCAAATTTCAGTGGTGAAGAAAGAGGATTGGCTGTGGGCTCTAGATCCAATTCACCGTAT
CGTCAGATAGACGTGCCACGAAGCATAGAGAATGGATCAGATTCGGATGAAGCTGGAGAACTTGCGAGTCCTCTC
CCTGATCAGCGTCATTCACTTCCCACATCGTCTCGCTCGGAGAATGGCGAATCTAAGGAAACGCAATCGCCTGTT
TTGAGTGAGGATTATTCTGCCTTGTCTCAGGAAACTTCGGATGACATGTCGGAATCGTCACCTGTCGAACGTCTT
TCGCATGCAACTTTCATTGCCCCTGCGCTCCCCCCCATCCGATTTTCCTTAAACGCGGCAGATTTCAGTGAATTG
TTGAGCTCCGTCCAAGGTTCTTCCGCGCTGAAGTCTCTTGACCAAATGGCATCTCTCTTACAAGAATCTGACAAT
GCCTCTGCGCCCCTCAAAGCCTCTTCTGGAAAGACCATGACCACGGTCACCAAATCTTCGGCCACCACAGCGAAT
GGGCACCAAACCGGCAAAACGGGGGAACATACTACCCCTAATAGCAGACCCTCCGGAATCAGTGGAAAAAATTCG
CCAGAAAACAAGCCGCTGCCGAATCCGAATCTTCTTTCTGATCGTGAATCATTGAGTAGTGAATCTCTGGATCCA
TCTAAAGATCCTCGTGTAACGGTGACTTCCGCTGGCTCGGAAGAAACATCGACGCGACATGACATGACAGATTCT
GTTGTTACGCGATTACGAAGAGTGCTCAAAGATTCACGAGACCACGGTTTGCAGCACATCAATCTGGAGATCGAT
TTTGCGGTAGCAGTACTCGAGACACTGGACTCCCGCAAGATGGTTTACGAGGATTTGAAAGAAAAATTCGATGGA
GTCAAGAGAACAAGCAGGAACCTCACTGAGGGTGTATCCGCTGCGCAGGCTGAATATGACAAGGAACAAAAGGCA
AGGCGTGATGCGGAAGCAGAAGTCACTCGGTTGCGGGTTCTGCTCTCTGGCCAAGCGGCCAAGCTGATGGCAATG
TCTGGTGACGATCGGCGCCAGGAACTCAGGCAACAGATATCCAAAGAATTGAATGACAATCTGTCTGGCCTTGAA
CAAGACCTCTCGAGGTTGAAGCTAGAACGGGACATTGCGCTGGCAGAGGTGGAAGAGCTCTCATCAACCAAGAGT
CTAGCATCCAATGAGAAATCCTCGGTGAATCTTGGAAGATCCGTTACAAAACGTCTGGACGGTTTAAGGAGACAA
TACCAAAGGGATCTGATTCCACTTACCGAGGAAAGAGAAAGGCTTGGTCGGGAGATTGCCGAACTCAAAGCAATC
CGTGACACATTTCTTGAGGAGACAACTGCCCTTAATGCCCGTAATGAGGAGCTTGCTCAACTGAGTCATATATAT
TCTCGCCGATTGGAAGCGATTCCGGAAGCTCCACTCAAGCAAGGACATGTCAACAATGCATCTCGTCCTTCATTC
GAAAGACCTAAAAATCCTGGCCATACTACAACCCAGTCGGTTCTCCCTCTTGCGCCTTCTCTTAGTGCTTCCACA
AGTGGATCGTCCACAACCACTGTCCAAGACGAATATGACAGGCATATGAAGCATCCGTCTAGATCAGATTCAGAT
TTCTCCTCTACACCTCGTAGATTGAAATGGATAGGATACAATAAAGGAAAAACAGCAGCCTCGTCAGCGGCGGCA
CAAGACGCCCAGAGAAGCAAGGGCCATTTAGAGCATACTTTCCAGCAGATCAGCGTATTACGTTTCACTCGATGT
GACCATTGCGCAGAAAAATTATGGGGCTCTCAATTGCGTTGTTCGGTTTGCAACATCTCAATCCACGTTCGCTGC
GTGGCTGCTGTTCAAACGTCTTGTGCGCAGCGGCACGGGGATGACCCTCAAGCTCCTTTACCTCCTTCGATGTTC
GGCCGGGACTTGATTGAGCAAGCGCAATATGACGGTCGGGGTGATGATCGACAAGTTCCCATCCTCGTTGAAAAA
TGTGTTCAGGCTGTTGAGGCGATTGCGCTCGATTATGAAGGTATCTACCGCAAGACGGGTGGTTCAAGCCAATCG
AAGATGATTGCCCAATTGTTTGAACGCGGAGATTATACAACATTCGACTTGCTTGACACCGACAGATTTAATGAT
ATCTGCAGCGTCACATCGGTTTTGAAAACCTATTTCCGCTCATTACCCAACCCACTCCTTACATTTGCCCTATAC
AAGTCATTCGTGGAAGCTATTTCCATTAAGGACATTGCGATCAGGGACAAGACATTATCCGATCTCGTTAAGCAG
CTACCCAGTGAGCATTACTATACACTGCGTGTATTGATGATACACCTTCACCATGTACATCAACGGAACGATACG
AACTTGATGAATGCAAGGAACCTGGGAGTGGTTTTCGGACCGACCCTCATCAGGTCCCCTGATCCTGGCGCTGAA
TTCGGCGACATGGCCCAGAGAGCCCTCTTTATTGAATGGCTCGTTGAAAATGCTCCTCGAGTATTCACCGGAGCT
GCATAG
Gene >AgabiH97|045630
ATGCTCGCTTCCATGGCCTCCCCCACACTCGCCGCTCCCCTCCACGAACAGTCCCACGTCGAGGTACCCCACATC
ACGCGCGATCTCGGTCTTGACGAGAGAATATGTCCGGGGTGTAAAAAATCCGCCGTGAGCGAAGAAGGCGGCCTT
GTCGTAGCCTTCGGGTCAGTCGCTTTTATTCCGCTATATTTCATCATAATCGCATCCTCGTTATCTACCTTAATG
CGGCTTCTTGATCCTGATTTACCACTTTGCGATATCTCATAGACGAAACTAACTTTCGCCCGCCATAGTCAATCA
TTCTTCCATGTCGACTGCTTCAAGTGCGCCAAATGCGGCAACCATGTCACCGCAGATACCAACCTTCTACTACTG
TCCGATGGTTCCCCCATATGCGCCAACTGCTCCTACAGCTGCAACGTCTGTCACCTTCCCATCCTCGACGAAGCC
ATCATGACTGGCGACGATTCTTATCATGCACACTGCTTCAAATGTAAAGTATGCAAGAACAGGATCGATGAGCTT
GTCTTCGCCAAGACCAGCCAGGGCATCTATTGTATGAGCTGTCACAATGAGCGTATGATCAAAATAAGGAAGTAT
ACTCAGAAAAAGGCTGAACGCGAACGCAATGCTGGCGGTGAATCCGGTAGGGCACGGGATCGAGACGCTCGAAAT
TACATCCGAGATGCTGTGCGTGTTATACAATTATCGGTTAGGTTCTAATTTGATTTTTGTCAATTAGTCTCCGGG
TTACGACTCAATTTCCCGTCCGTCGTCGTCCAAGTCCACGGGGAATCTGGCAGCGGCTGCGCGGCAAGATATGTC
TCGACCCAGTACGGCGCGCAGCACCGAAAGTTCGGCATATACCCGGCCAATCGTCAAACCCAAAGGTCCACCACA
AGTTTACAATGGACAAGATAGTCGGAGCGCGACTTCGCAATCTGCCTCCCATCAGAATACGACTACACCTATTCC
CTCGCCCTCTTTTTCCCCGACTCCTGTCACCAATGAACACTCGACCGTAAATCAAAAGTCTCATCACGACGTATC
CCCTACACTTAACGTAAACCTTACACCCACGAGTTTGGAACCCAACGCTAAACGTCGAAGCTATGATGACGGAGT
TCGTCCTTTACAAATTCTCTTTGGCCAAAAGCAAGCTACGTCAGGTAACACTACCCTTCGACCGGACACAAAAGC
AGCTGCTTCGGGAAGTCTGACGGTCACTTCGCGACAGCAGAAGCGTCGTTCCATCAATCCTGGCTTGGTCCTTCC
TAATATCAGCATGGCACTTCCATCCGGACTAAACACCAGGCTGTCTCCCGTCTCATCTACATCCTCAGATTTCCA
GTCAGCTCGTTCTACGAATCCAGTGGGTTCAGAAGCTGGACAAGAGCAGGTTTCTCGACCTACATCTCAAGACGC
TTCTACCCATAGTCATGATCCTTCCCGGGAAACAACAAGCAAAGGATGGGAGCACTCGTCTTCCACAGTCGCTCG
AGATAATGGGGATCAGAGATTGGTACTCAAACATTTAGAATCTCCATCTCCATCTCTGAGTCCGGCTATCCGATT
AGCAACGAGTCAAGCCGACGATGCCAGCAGTAGGCTGTCGTCAACATCAAATTTCAGTGGTGAAGAAAGAGGATT
GGCTGTGGGCTCTAGATCCAATTCACCGTATCGTCAGATAGACGTGCCACGAAGCATAGAGAATGGATCAGATTC
GGATGAAGCTGGAGAACTTGCGAGTCCTCTCCCTGATCAGCGTCATTCACTTCCCACATCGTCTCGCTCGGAGAA
TGGCGAATCTAAGGAAACGCAATCGCCTGTTTTGAGTGAGGATTATTCTGCCTTGTCTCAGGAAACTTCGGATGA
CATGTCGGAATCGTCACCTGTCGAACGTCTTTCGCATGCAACTTTCATTGCCCCTGCGCTCCCCCCCATCCGATT
TTCCTTAAACGCGGCAGATTTCAGTGAATTGTTGAGCTCCGTCCAAGGTTCTTCCGCGCTGAAGTCTCTTGACCA
AATGGCATCTCTCTTACAAGAATCTGACAATGCCTCTGCGCCCCTCAAAGCCTCTTCTGGAAAGACCATGACCAC
GGTCACCAAATCTTCGGCCACCACAGCGAATGGGCACCAAACCGGCAAAACGGGGGAACATACTACCCCTAATAG
CAGGTAAGTCCTCACACTTTCCACTTTTACCTCGCCTTACACTTGCATAGACCCTCCGGAATCAGTGGAAAAAAT
TCGCCAGAAAACAAGCCGCTGCCGAATCCGAATCTTCTTTCTGATCGTGAATCATTGAGTAGTGAATCTCTGGAT
CCATCTAAAGATCCTCGTGTAACGGTGACTTCCGCTGGCTCGGAAGAAACATCGACGCGACATGACATGACAGAT
TCTGTTGTTACGCGATTACGAAGAGTGCTCAAAGATTCACGAGACCACGGTTTGCAGCACATCAATCTGGAGATC
GATTTTGCGGTAGCAGTACTCGAGACACTGGACTCCCGCAAGATGGTTTACGAGGATTTGAAAGAAAAATTCGAT
GGAGTCAAGGTCAGTACCGATTCGAATGGCTTACATTTCAACAAGCTCAAAACAGACAGAGAACAAGCAGGAACC
TCACTGAGGGTGTATCCGCTGCGCAGGCTGAATATGACAAGGAACAAAAGGCAAGGCGTGATGCGGAAGCAGAAG
TCACTCGGTTGCGGGTTCTGCTCTCTGGCCAAGCGGCCAAGCTGATGGCAATGTCTGGTGACGATCGGCGCCAGG
AACTCAGGCAACAGATATCCAAAGAATTGAATGACAATCTGTCTGGCCTTGAACAAGACCTCTCGAGGTTGAAGC
TAGAACGGGACATTGCGCTGGCAGAGGTGGAAGAGCTCTCATCAACCAAGAGGTAAGACAAGTGAAAGTTCTGCA
TCTTTCCGTCATAATAACATCTTCACAGTCTAGCATCCAATGAGAAATCCTCGGTGAATCTTGGAAGATCCGTTA
CAAAACGTCTGGACGGTTTAAGGAGACAATACCAAAGGGATCTGATTCCACTTACCGAGGAAAGAGAAAGGCTTG
GTCGGGAGATTGCCGAACTCAAAGCAATCCGTGACACATTTCTTGAGGAGACAACTGCCCTTAATGCCCGTAATG
AGGAGCTTGCTCAACTGAGTCATATATATTCTCGCCGATTGGAAGCGATTCCGGAAGCTCCACTCAAGCAAGGAC
ATGTCAACAATGCATCTCGTCCTTCATTCGAAAGACCTAAAAATCCTGGCCATACTACAACCCAGTCGGTTCTCC
CTCTTGCGCCTTCTCTTAGTGCTTCCACAAGTGGATCGTCCACAACCACTGTCCAAGACGAATATGACAGGCATA
TGAAGCATCCGTCTAGATCAGATTCAGATTTCTCCTCTACACCTCGTAGATTGAAATGGATAGGATACAATAAAG
GAAAAACAGCAGCCTCGTCAGCGGCGGCACAAGACGCCCAGAGAAGCAAGGGCCATTTAGAGCATACTTTCCAGC
AGATCAGCGTATTACGTTTCACTCGATGTGACCATTGCGCAGAAAAATTATGGGGCTCTCAATTGCGTTGTTCGG
GTACGTTCAGGCATGCAAGGCATGCAGTTTTAGCGCTGATGCTTAAATTTGATCGTTAGTTTGCAACATCTCAAT
CCACGTTCGCTGCGTGGCTGCTGTTCAAACGTCTTGTGCGCAGCGGCACGGGGATGACCCTCAAGCTCCTTTACG
TAGGTCGCTGCGATATCTGTTCTACCCGTTTCTTATCAGTCGTGCAAGCTCCTTCGATGTTCGGCCGGGACTTGA
TTGAGCAAGCGCAATATGACGGTCGGGGTGATGATCGACAAGTTCCCATCCTCGTTGAAAAATGTGTTCAGGCTG
TTGAGGCGATTGGTGCGGCAGCCATTTATCTTTTCCGAAGAGACCACTGACATCGCATCGTAGCGCTCGATTATG
AAGGTATCTACCGCAAGACGGGTGGTTCAAGCCAATCGAAGATGATTGCCCAATTGTTTGAACGCGGAGATTATA
CAACATTCGACTTGCTTGACACCGACAGATTTAATGATATCTGCAGCGTCACATCGGTTTTGAAAACCTATTTCC
GCTCATTACCCAACCCACTCCTTACATTTGCCCTATACAAGTCATTCGTGGAAGCTATTTCCATTAAGGACATTG
CGATCAGGGACAAGACATTATCCGATCTCGTTAAGCAGCTACCCAGTGAGCATTACTATACACTGCGTGTATTGA
TGATACACCTTCACCAGTAAGTCTAGTATTTCTTCTAACATTGAATGCTGAACGAATGGGCTATATCACAGTGTA
CATCAACGGAACGATACGAACTTGATGAATGCAAGGAACCTGGGAGTGGTTTTCGGACGTTCGTATCTGCCTCAC
AGATGACTTTACTCGTGCTAATGGTCTTTTCCAGCGACCCTCATCAGGTCCCCTGATCCTGGCGCTGAATTCGGC
GACATGGCCCAGAGAGCCCTCTTTATTGAATGGCTCGTTGAAAATGCTCCTCGAGTATTCACCGGAGCTGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail