Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045580
Gene name
Locationscaffold_2:1738956..1739767
Strand+
Gene length (bp)811
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00025 Arf ADP-ribosylation factor family 2.2E-77 6 177
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 7.6E-15 19 129
PF00071 Ras Ras family 5.9E-13 20 142
PF09439 SRPRB Signal recognition particle receptor beta subunit 1.6E-11 16 143
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 4.2E-08 19 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 5 178 3.0E-103
sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 5 178 9.0E-103
sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 5 178 9.0E-103
sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 5 178 9.0E-103
sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 5 178 9.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 5 178 3.0E-103
sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 5 178 9.0E-103
sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 5 178 9.0E-103
sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 5 178 9.0E-103
sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 5 178 9.0E-103
sp|P40946|ARF3_DROME ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 5 178 9.0E-101
sp|P51645|ARF6_XENLA ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 5 178 2.0E-100
sp|Q9Y7Z2|ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 5 178 1.0E-99
sp|P0CM16|ARF_CRYNJ ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 1 180 1.0E-95
sp|P0CM17|ARF_CRYNB ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 1 180 1.0E-95
sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2 1 180 1.0E-94
sp|P91924|ARF_DUGJA ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3 1 182 6.0E-94
sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 1 180 8.0E-94
sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 1 180 7.0E-93
sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 1 180 8.0E-93
sp|O48920|ARF_VIGUN ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 1 180 9.0E-93
sp|P36579|ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 1 180 2.0E-92
sp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 1 177 3.0E-92
sp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 1 177 3.0E-92
sp|P36397|ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 1 180 5.0E-92
sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 1 180 7.0E-92
sp|P51822|ARF1_DAUCA ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 1 180 1.0E-91
sp|P51824|ARF1_SOLTU ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2 1 181 2.0E-91
sp|Q61LA8|ARF12_CAEBR ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3 1 180 8.0E-91
sp|Q75A26|ARF_ASHGO ADP-ribosylation factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARF1 PE=3 SV=3 1 180 8.0E-91
sp|Q7RVM2|ARF_NEUCR ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08340 PE=3 SV=3 1 180 1.0E-90
sp|P84082|ARF2_RAT ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1 1 181 2.0E-90
sp|Q8BSL7|ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2 1 181 2.0E-90
sp|P84081|ARF2_BOVIN ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1 1 181 2.0E-90
sp|Q10943|ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2 1 180 2.0E-90
sp|P61210|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 1 179 4.0E-90
sp|P61209|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 1 179 4.0E-90
sp|P34727|ARF_AJECA ADP-ribosylation factor OS=Ajellomyces capsulatus GN=ARF PE=1 SV=3 1 179 5.0E-90
sp|P51643|ARF1_XENLA ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 1 181 5.0E-90
sp|P84079|ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2 1 181 8.0E-90
sp|P84078|ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2 1 181 8.0E-90
sp|Q4R5P2|ARF1_MACFA ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3 1 181 8.0E-90
sp|P84077|ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2 1 181 8.0E-90
sp|P84080|ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2 1 181 8.0E-90
sp|P61207|ARF3_TAKRU ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2 1 181 2.0E-89
sp|P61206|ARF3_RAT ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2 1 181 2.0E-89
sp|Q5R5P7|ARF3_PONAB ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3 1 181 2.0E-89
sp|P61205|ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2 1 181 2.0E-89
sp|P61204|ARF3_HUMAN ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2 1 181 2.0E-89
sp|Q5E9I6|ARF3_BOVIN ADP-ribosylation factor 3 OS=Bos taurus GN=ARF3 PE=2 SV=3 1 181 2.0E-89
sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 1 180 4.0E-89
sp|P22274|ARF_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF1 PE=3 SV=4 1 179 3.0E-88
sp|P51644|ARF4_XENLA ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=1 SV=2 1 180 9.0E-88
sp|Q3SZF2|ARF4_BOVIN ADP-ribosylation factor 4 OS=Bos taurus GN=ARF4 PE=2 SV=3 1 180 1.0E-87
sp|P19146|ARF2_YEAST ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3 1 180 3.0E-87
sp|Q94650|ARF1_PLAFA ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 1 179 1.0E-86
sp|Q7KQL3|ARF1_PLAF7 ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) GN=ARF1 PE=1 SV=1 1 179 1.0E-86
sp|O00909|ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum GN=arfA PE=1 SV=3 1 177 1.0E-86
sp|P49702|ARF5_CHICK ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2 1 180 4.0E-86
sp|P40945|ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster GN=Arf102F PE=2 SV=2 1 180 4.0E-86
sp|P11076|ARF1_YEAST ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF1 PE=1 SV=3 1 179 5.0E-86
sp|P61751|ARF4_RAT ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2 1 180 7.0E-86
sp|P61750|ARF4_MOUSE ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=1 SV=2 1 180 7.0E-86
sp|P84083|ARF5_RAT ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2 1 180 1.0E-85
sp|P84084|ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=1 SV=2 1 180 1.0E-85
sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2 1 180 1.0E-85
sp|Q5RCF1|ARF4_PONAB ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3 1 180 1.0E-85
sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3 1 180 1.0E-85
sp|Q25761|ARF1_PLAFO ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2 1 179 2.0E-85
sp|P26991|ARF_GIAIN ADP-ribosylation factor OS=Giardia intestinalis PE=3 SV=3 1 177 5.0E-81
sp|P40994|ARF3_YEAST ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF3 PE=1 SV=2 1 176 7.0E-77
sp|Q96361|ARF1_BRARP ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 1 178 8.0E-74
sp|P40940|ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 1 178 1.0E-73
sp|Q9SHU5|ARF4_ARATH Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3 1 182 4.0E-72
sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 1 181 4.0E-69
sp|Q94231|ARF11_CAEEL ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3 1 178 1.0E-67
sp|Q54V47|ARFJ_DICDI ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1 14 180 2.0E-67
sp|Q2YDM1|ARL1_BOVIN ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1 15 181 2.0E-66
sp|P61212|ARL1_RAT ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 15 181 2.0E-66
sp|P61211|ARL1_MOUSE ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 15 181 2.0E-66
sp|P40616|ARL1_HUMAN ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1 15 181 3.0E-65
sp|Q54V41|ARFK_DICDI ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1 14 180 6.0E-65
sp|P25160|ARL1_DROME ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arl1 PE=2 SV=5 1 181 3.0E-64
sp|Q54JJ3|ARFH_DICDI ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1 4 180 4.0E-64
sp|Q54I24|ARFD_DICDI ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2 1 177 3.0E-61
sp|P36407|TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2 17 177 4.0E-61
sp|Q8BGX0|TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1 17 177 5.0E-61
sp|P36406|TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1 17 177 5.0E-61
sp|Q20758|ARL1_CAEEL ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 1 181 2.0E-60
sp|Q54HK2|ARFF_DICDI ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1 14 176 6.0E-57
sp|Q55AD9|ARL5_DICDI ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1 1 179 2.0E-55
sp|Q9D4P0|ARL5B_MOUSE ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3 1 180 8.0E-55
sp|Q96KC2|ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1 1 180 8.0E-55
sp|Q2KJ96|ARL5A_BOVIN ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1 11 180 2.0E-54
sp|Q80ZU0|ARL5A_MOUSE ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=1 SV=1 11 180 2.0E-54
sp|Q9Y689|ARL5A_HUMAN ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1 11 180 2.0E-53
sp|P51646|ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1 11 180 2.0E-53
sp|Q8N4G2|ARL14_HUMAN ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=2 15 178 2.0E-52
sp|P61208|ARL4C_MOUSE ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1 16 182 2.0E-51
sp|P56559|ARL4C_HUMAN ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=1 SV=1 16 182 2.0E-51
sp|P34212|ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=3 SV=3 1 177 1.0E-50
sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 16 180 4.0E-50
sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 16 180 9.0E-50
sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 16 180 9.0E-50
sp|O08697|ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 16 180 5.0E-49
sp|Q8QHI3|ARL3_XENLA ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1 16 182 6.0E-49
sp|B5FYQ0|ARL3_TAEGU ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1 16 182 7.0E-49
sp|Q1MTE5|ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1 16 182 3.0E-48
sp|P61214|ARL4A_RAT ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1 1 182 5.0E-48
sp|P61213|ARL4A_MOUSE ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1 1 182 5.0E-48
sp|Q3T0M9|ARL4A_BOVIN ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1 1 182 5.0E-48
sp|P40617|ARL4A_HUMAN ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=1 SV=2 1 182 5.0E-48
sp|Q9ZPX1|ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana GN=ARL2 PE=2 SV=1 18 180 6.0E-48
sp|O45379|ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1 16 178 9.0E-48
sp|Q6P068|ARL5C_MOUSE ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1 1 173 1.0E-47
sp|Q3SXC5|ARL14_MOUSE ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1 15 178 1.0E-47
sp|A8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 OS=Chlamydomonas reinhardtii GN=ARL3 PE=1 SV=2 17 178 6.0E-47
sp|P37996|ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2 16 182 2.0E-45
sp|Q19705|ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 16 180 5.0E-45
sp|Q52NJ4|ARL3_PIG ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1 16 182 5.0E-45
sp|Q2TBW6|ARL3_BOVIN ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1 16 182 6.0E-45
sp|Q9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1 16 182 7.0E-45
sp|Q627K4|ARL2_CAEBR ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 16 180 1.0E-44
sp|P36405|ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2 16 182 2.0E-44
sp|Q06849|ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arl2 PE=2 SV=2 16 180 2.0E-44
sp|Q99PE9|ARL4D_MOUSE ADP-ribosylation factor-like protein 4D OS=Mus musculus GN=Arl4d PE=2 SV=2 16 182 9.0E-44
sp|Q6P3A9|ARL11_MOUSE ADP-ribosylation factor-like protein 11 OS=Mus musculus GN=Arl11 PE=2 SV=1 17 180 2.0E-43
sp|Q58DI9|ARL11_BOVIN ADP-ribosylation factor-like protein 11 OS=Bos taurus GN=ARL11 PE=2 SV=1 17 179 1.0E-41
sp|Q54UF1|ARL2_DICDI ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1 19 180 3.0E-41
sp|Q969Q4|ARL11_HUMAN ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1 17 180 4.0E-41
sp|A6NH57|ARL5C_HUMAN Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=3 SV=4 1 173 6.0E-40
sp|Q5BK71|ARL11_RAT ADP-ribosylation factor-like protein 11 OS=Rattus norvegicus GN=Arl11 PE=2 SV=1 19 173 6.0E-40
sp|Q60Z38|ARL6_CAEBR ADP-ribosylation factor-like protein 6 OS=Caenorhabditis briggsae GN=arl-6 PE=3 SV=1 7 179 3.0E-39
sp|Q18510|ARL6_CAEEL ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans GN=arl-6 PE=2 SV=1 7 179 7.0E-39
sp|Q5REU3|ARL4D_PONAB ADP-ribosylation factor-like protein 4D OS=Pongo abelii GN=ARL4D PE=2 SV=1 16 182 1.0E-38
sp|P49703|ARL4D_HUMAN ADP-ribosylation factor-like protein 4D OS=Homo sapiens GN=ARL4D PE=1 SV=2 16 182 1.0E-38
sp|Q5R4G5|ARL6_PONAB ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1 16 178 1.0E-38
sp|Q9H0F7|ARL6_HUMAN ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1 16 178 1.0E-38
sp|Q0VC18|ARL4D_BOVIN ADP-ribosylation factor-like protein 4D OS=Bos taurus GN=ARL4D PE=2 SV=1 16 182 1.0E-38
sp|Q5M9P8|ARL6_DANRE ADP-ribosylation factor-like protein 6 OS=Danio rerio GN=arl6 PE=2 SV=1 16 178 2.0E-38
sp|O88848|ARL6_MOUSE ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=1 SV=1 16 178 7.0E-38
sp|Q0IIM2|ARL6_BOVIN ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=1 SV=1 16 178 7.0E-38
sp|Q09767|ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp41 PE=3 SV=1 16 179 2.0E-37
sp|Q96BM9|ARL8A_HUMAN ADP-ribosylation factor-like protein 8A OS=Homo sapiens GN=ARL8A PE=1 SV=1 12 181 4.0E-36
sp|Q5ZKQ8|ARL8A_CHICK ADP-ribosylation factor-like protein 8A OS=Gallus gallus GN=ARL8A PE=2 SV=1 12 181 5.0E-36
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 12 181 7.0E-36
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 12 181 7.0E-36
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 12 181 7.0E-36
sp|Q6NZW8|AR8BA_DANRE ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1 12 181 9.0E-36
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 12 181 2.0E-35
sp|Q2KI07|ARL8B_BOVIN ADP-ribosylation factor-like protein 8B OS=Bos taurus GN=ARL8B PE=2 SV=1 12 181 3.0E-35
sp|Q6P8C8|ARL8A_XENTR ADP-ribosylation factor-like protein 8A OS=Xenopus tropicalis GN=arl8a PE=2 SV=1 12 181 5.0E-35
sp|Q8VEH3|ARL8A_MOUSE ADP-ribosylation factor-like protein 8A OS=Mus musculus GN=Arl8a PE=1 SV=1 12 181 7.0E-35
sp|Q5R6E7|ARL8B_PONAB ADP-ribosylation factor-like protein 8B OS=Pongo abelii GN=ARL8B PE=2 SV=1 12 181 2.0E-34
sp|Q5RCQ6|ARL3_PONAB ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1 16 182 1.0E-33
sp|Q9VHV5|ARL8_DROME ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1 12 182 3.0E-32
sp|Q4P0I7|SAR1_USTMA Small COPII coat GTPase SAR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SAR1 PE=3 SV=1 16 177 9.0E-31
sp|P0CR30|SAR1_CRYNJ Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SAR1 PE=3 SV=1 15 177 3.0E-30
sp|P0CR31|SAR1_CRYNB Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SAR1 PE=3 SV=1 15 177 3.0E-30
sp|Q54R04|ARL8_DICDI ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1 12 173 4.0E-30
sp|Q0UKC0|SAR1_PHANO Small COPII coat GTPase SAR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SAR1 PE=3 SV=2 15 177 5.0E-30
sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 4 180 7.0E-30
sp|Q09654|TRI23_CAEEL E3 ubiquitin-protein ligase arc-1 OS=Caenorhabditis elegans GN=arc-1 PE=3 SV=3 17 129 2.0E-29
sp|P20606|SAR1_YEAST Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAR1 PE=1 SV=1 15 177 3.0E-29
sp|P0CT17|SAR1_MAGOY Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain Y34) GN=SAR1 PE=2 SV=1 15 177 5.0E-29
sp|P0CT16|SAR1_MAGO7 Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SAR1 PE=3 SV=1 15 177 5.0E-29
sp|P78976|SAR1_HYPJE Small COPII coat GTPase sar1 OS=Hypocrea jecorina GN=sar1 PE=3 SV=1 15 177 5.0E-29
sp|A1CRG9|SAR1_ASPCL Small COPII coat GTPase sar1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sar1 PE=3 SV=1 15 177 9.0E-29
sp|A1D4D1|SAR1_NEOFI Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1 15 177 1.0E-28
sp|Q4WJS7|SAR1_ASPFU Small COPII coat GTPase sar1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sar1 PE=3 SV=1 15 177 1.0E-28
sp|Q01475|SAR1_SCHPO Small COPII coat GTPase sar1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sar1 PE=1 SV=1 15 177 1.0E-28
sp|Q8IVW1|ARL17_HUMAN ADP-ribosylation factor-like protein 17 OS=Homo sapiens GN=ARL17A PE=2 SV=2 1 87 2.0E-28
sp|P0C583|SAR1_NEUCR Small COPII coat GTPase sar1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vtr-7 PE=3 SV=1 15 177 2.0E-28
sp|Q5BGB9|SAR1_EMENI Small COPII coat GTPase sar1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sar1 PE=3 SV=1 15 177 3.0E-28
sp|P0C951|SAR1_ASPNC Small COPII coat GTPase SAR1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sar1 PE=3 SV=1 4 177 3.0E-28
sp|Q877B9|SAR1_ASPOR Small COPII coat GTPase sar1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sar1 PE=3 SV=1 15 177 5.0E-28
sp|Q2HA55|SAR1_CHAGB Small COPII coat GTPase SAR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SAR1 PE=3 SV=2 15 175 6.0E-28
sp|Q0CUN7|SAR1_ASPTN Small COPII coat GTPase sar1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sar1 PE=3 SV=1 15 177 9.0E-28
sp|Q6FUZ9|SAR1_CANGA Small COPII coat GTPase SAR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SAR1 PE=3 SV=1 15 177 1.0E-27
sp|Q6CB54|SAR1_YARLI Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SAR1 PE=3 SV=1 15 177 1.0E-27
sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 12 177 1.0E-27
sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=1 SV=2 12 177 1.0E-27
sp|P52884|SAR2_SOLLC GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1 16 178 2.0E-27
sp|A8INQ0|ARL13_CHLRE ADP-ribosylation factor-like protein 13B OS=Chlamydomonas reinhardtii GN=ARL13 PE=1 SV=1 16 179 3.0E-27
sp|A3LTA2|SAR1_PICST Small COPII coat GTPase SAR1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SAR1 PE=3 SV=1 15 177 3.0E-27
sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 12 177 4.0E-27
sp|P0C950|SAR1_ASPNG Small COPII coat GTPase SAR1 OS=Aspergillus niger GN=sar1 PE=3 SV=1 4 177 5.0E-27
sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 12 177 6.0E-27
sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 12 177 6.0E-27
sp|O04266|SAR1A_BRACM GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1 16 178 3.0E-26
sp|Q755D7|SAR1_ASHGO Small COPII coat GTPase SAR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SAR1 PE=3 SV=1 15 177 3.0E-26
sp|O04834|SAR1A_ARATH GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1 16 178 5.0E-26
sp|Q59S78|SAR1_CANAL Small COPII coat GTPase SAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAR1 PE=3 SV=2 15 177 1.0E-25
sp|A5E5G3|SAR1_LODEL Small COPII coat GTPase SAR1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SAR1 PE=3 SV=2 15 177 2.0E-25
sp|Q5EA19|ARL15_BOVIN ADP-ribosylation factor-like protein 15 OS=Bos taurus GN=ARL15 PE=2 SV=1 17 173 2.0E-25
sp|Q01474|SAR1B_ARATH GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=1 SV=1 16 177 2.0E-25
sp|Q6CWR7|SAR1_KLULA Small COPII coat GTPase SAR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SAR1 PE=3 SV=1 15 177 7.0E-25
sp|Q23445|SAR1_CAEEL GTP-binding protein SAR1 OS=Caenorhabditis elegans GN=ZK180.4 PE=3 SV=1 13 175 9.0E-25
sp|O04267|SAR1B_BRACM GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1 16 177 1.0E-24
sp|Q5RFN0|ARL15_PONAB ADP-ribosylation factor-like protein 15 OS=Pongo abelii GN=ARL15 PE=2 SV=1 17 157 1.0E-24
sp|Q9NXU5|ARL15_HUMAN ADP-ribosylation factor-like protein 15 OS=Homo sapiens GN=ARL15 PE=1 SV=1 17 157 1.0E-24
sp|Q6BVA7|SAR1_DEBHA Small COPII coat GTPase SAR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SAR1 PE=3 SV=1 15 177 1.0E-24
sp|Q9P4C8|SAR1_PICPG Small COPII coat GTPase SAR1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SAR1 PE=3 SV=1 15 177 2.0E-24
sp|A5DR82|SAR1_PICGU Small COPII coat GTPase SAR1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SAR1 PE=3 SV=3 15 177 2.0E-24
sp|Q9CQC9|SAR1B_MOUSE GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b PE=1 SV=1 16 177 2.0E-24
sp|Q9QVY3|SAR1B_CRIGR GTP-binding protein SAR1b OS=Cricetulus griseus GN=SAR1B PE=1 SV=1 16 177 3.0E-24
sp|Q8SQH8|ARF_ENCCU ADP-ribosylation factor OS=Encephalitozoon cuniculi (strain GB-M1) GN=ARF-1 PE=1 SV=3 6 143 3.0E-24
sp|Q9Y6B6|SAR1B_HUMAN GTP-binding protein SAR1b OS=Homo sapiens GN=SAR1B PE=1 SV=1 16 177 3.0E-24
sp|Q5HZY2|SAR1B_RAT GTP-binding protein SAR1b OS=Rattus norvegicus GN=Sar1b PE=2 SV=1 16 177 4.0E-24
sp|Q5PYH3|SAR1B_PIG GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B PE=2 SV=1 16 177 4.0E-24
sp|Q3T0T7|SAR1B_BOVIN GTP-binding protein SAR1b OS=Bos taurus GN=SAR1B PE=2 SV=1 16 177 4.0E-24
sp|Q8BGR6|ARL15_MOUSE ADP-ribosylation factor-like protein 15 OS=Mus musculus GN=Arl15 PE=1 SV=1 17 157 4.0E-24
sp|Q54Y14|SAR1B_DICDI GTP-binding protein Sar1B OS=Dictyostelium discoideum GN=sarB PE=3 SV=1 13 175 6.0E-24
sp|Q640N2|AR13B_MOUSE ADP-ribosylation factor-like protein 13B OS=Mus musculus GN=Arl13b PE=1 SV=2 16 173 7.0E-24
sp|Q3SXY8|AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens GN=ARL13B PE=1 SV=1 16 173 1.0E-23
sp|Q5R548|SAR1A_PONAB GTP-binding protein SAR1a OS=Pongo abelii GN=SAR1A PE=2 SV=1 16 177 1.0E-23
sp|Q9NR31|SAR1A_HUMAN GTP-binding protein SAR1a OS=Homo sapiens GN=SAR1A PE=1 SV=1 16 177 1.0E-23
sp|Q52NJ3|SAR1A_PIG GTP-binding protein SAR1a OS=Sus scrofa GN=SAR1A PE=2 SV=1 16 177 1.0E-23
sp|Q3T0D7|SAR1A_BOVIN GTP-binding protein SAR1a OS=Bos taurus GN=SAR1A PE=2 SV=1 16 177 1.0E-23
sp|P36536|SAR1A_MOUSE GTP-binding protein SAR1a OS=Mus musculus GN=Sar1a PE=1 SV=1 16 177 1.0E-22
sp|Q8MQT8|SAR1_GIAIN GTP-binding protein Sar1 OS=Giardia intestinalis GN=SAR1 PE=3 SV=1 16 175 1.0E-22
sp|P39110|CIN4_YEAST GTP-binding protein CIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN4 PE=1 SV=1 15 130 1.0E-21
sp|Q1ZXA5|ARLX_DICDI ADP-ribosylation factor-like protein DDB_G0292332 OS=Dictyostelium discoideum GN=DDB_G0292332 PE=3 SV=1 9 130 3.0E-21
sp|Q559R0|SAR1A_DICDI GTP-binding protein Sar1A OS=Dictyostelium discoideum GN=sarA PE=1 SV=1 15 175 1.0E-20
sp|Q6T311|ARL9_HUMAN ADP-ribosylation factor-like protein 9 OS=Homo sapiens GN=ARL9 PE=2 SV=1 16 155 2.0E-20
sp|Q8JHI3|AR13B_DANRE ADP-ribosylation factor-like protein 13B OS=Danio rerio GN=arl13b PE=1 SV=1 15 179 4.0E-20
sp|Q9QXJ4|ARL10_MOUSE ADP-ribosylation factor-like protein 10 OS=Mus musculus GN=Arl10 PE=1 SV=2 16 168 5.0E-20
sp|Q8N8L6|ARL10_HUMAN ADP-ribosylation factor-like protein 10 OS=Homo sapiens GN=ARL10 PE=2 SV=1 20 151 8.0E-20
sp|P52885|SAR1_TOBAC GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1 16 178 2.0E-17
sp|Q8SS09|SAR1_ENCCU Small COPII coat GTPase SAR1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SAR1 PE=1 SV=1 12 132 4.0E-16
sp|Q5H913|AR13A_HUMAN ADP-ribosylation factor-like protein 13A OS=Homo sapiens GN=ARL13A PE=2 SV=2 5 173 1.0E-15
sp|Q54YV7|ARFL_DICDI ADP-ribosylation factor L OS=Dictyostelium discoideum GN=arrL PE=3 SV=1 1 181 4.0E-15
sp|Q9D416|AR13A_MOUSE ADP-ribosylation factor-like protein 13A OS=Mus musculus GN=Arl13a PE=2 SV=1 20 173 4.0E-14
sp|Q6AXT3|AR13A_RAT ADP-ribosylation factor-like protein 13A OS=Rattus norvegicus GN=Arl13a PE=2 SV=1 16 173 2.0E-13
sp|Q0P5N6|ARL16_HUMAN ADP-ribosylation factor-like protein 16 OS=Homo sapiens GN=ARL16 PE=1 SV=1 14 139 2.0E-12
sp|Q5UQ27|RABL_MIMIV Probable Rab-related GTPase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R214 PE=3 SV=1 19 130 4.0E-12
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 18 144 3.0E-11
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 18 148 4.0E-11
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 18 180 4.0E-11
sp|H2L0N8|ARL13_CAEEL ADP-ribosylation factor-like protein 13B OS=Caenorhabditis elegans GN=arl-13 PE=1 SV=1 16 129 5.0E-11
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 18 130 6.0E-11
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 18 144 6.0E-11
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 18 131 2.0E-10
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 18 130 2.0E-10
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 18 131 3.0E-10
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 18 132 3.0E-10
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 14 150 3.0E-10
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 18 170 3.0E-10
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 18 132 4.0E-10
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 18 130 4.0E-10
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 18 130 5.0E-10
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 18 131 6.0E-10
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 18 131 6.0E-10
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 18 131 6.0E-10
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 18 130 7.0E-10
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 18 130 9.0E-10
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 18 130 1.0E-09
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 18 130 1.0E-09
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 18 130 1.0E-09
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 18 130 1.0E-09
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 18 130 1.0E-09
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 18 129 1.0E-09
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 18 130 1.0E-09
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 18 130 2.0E-09
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 18 170 2.0E-09
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 18 130 2.0E-09
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 18 130 2.0E-09
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 18 130 3.0E-09
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 18 130 3.0E-09
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 18 130 3.0E-09
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 18 130 3.0E-09
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 18 130 3.0E-09
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 18 130 3.0E-09
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 18 130 3.0E-09
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 18 130 3.0E-09
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 18 130 3.0E-09
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 18 130 3.0E-09
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 18 130 4.0E-09
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 18 145 4.0E-09
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 18 168 4.0E-09
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 18 145 4.0E-09
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 18 130 4.0E-09
sp|Q4VT42|GPA10_CAEBR Guanine nucleotide-binding protein alpha-10 subunit OS=Caenorhabditis briggsae GN=gpa-10 PE=3 SV=2 40 164 7.0E-09
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 1 130 7.0E-09
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 18 105 8.0E-09
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 18 105 8.0E-09
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 18 105 8.0E-09
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 18 130 8.0E-09
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 18 130 9.0E-09
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 18 138 9.0E-09
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 18 130 1.0E-08
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 18 145 1.0E-08
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 18 145 1.0E-08
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 16 177 1.0E-08
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 18 145 1.0E-08
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 18 130 1.0E-08
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 18 130 1.0E-08
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 18 145 1.0E-08
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 18 145 1.0E-08
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 18 145 1.0E-08
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 18 145 1.0E-08
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 18 166 2.0E-08
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 18 130 2.0E-08
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 18 145 2.0E-08
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 18 150 2.0E-08
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 18 145 2.0E-08
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 18 130 3.0E-08
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 18 130 3.0E-08
sp|Q9SF92|RAC2B_ARATH Ras-related protein RABC2b OS=Arabidopsis thaliana GN=RABC2B PE=2 SV=1 18 170 3.0E-08
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 5 149 3.0E-08
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 18 130 4.0E-08
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 5 110 5.0E-08
sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus GN=Rab22a PE=1 SV=2 16 130 5.0E-08
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 19 130 5.0E-08
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 18 130 6.0E-08
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 18 144 7.0E-08
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 5 110 8.0E-08
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 5 110 8.0E-08
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 5 110 9.0E-08
sp|P56371|RAB4A_MOUSE Ras-related protein Rab-4A OS=Mus musculus GN=Rab4a PE=1 SV=2 18 177 1.0E-07
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 5 177 1.0E-07
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 18 130 1.0E-07
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 19 130 1.0E-07
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 18 130 1.0E-07
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 18 138 2.0E-07
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 18 145 2.0E-07
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 18 130 2.0E-07
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 19 130 2.0E-07
sp|Q9UL26|RB22A_HUMAN Ras-related protein Rab-22A OS=Homo sapiens GN=RAB22A PE=1 SV=2 16 105 2.0E-07
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 14 166 2.0E-07
sp|P05714|RAB4A_RAT Ras-related protein Rab-4A OS=Rattus norvegicus GN=Rab4a PE=1 SV=3 18 177 2.0E-07
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 18 177 2.0E-07
sp|Q06AU4|RAB34_PIG Ras-related protein Rab-34 OS=Sus scrofa GN=RAB34 PE=2 SV=1 14 168 2.0E-07
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 18 130 2.0E-07
sp|Q6PHI9|RAB4A_DANRE Ras-related protein Rab-4A OS=Danio rerio GN=rab4a PE=2 SV=2 18 177 2.0E-07
sp|Q68EK7|RAB4B_DANRE Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 18 130 2.0E-07
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 18 110 3.0E-07
sp|P51154|RB22A_CANLF Ras-related protein Rab-22A OS=Canis lupus familiaris GN=RAB22A PE=1 SV=1 16 130 3.0E-07
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 14 130 3.0E-07
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 18 93 4.0E-07
sp|P20338|RAB4A_HUMAN Ras-related protein Rab-4A OS=Homo sapiens GN=RAB4A PE=1 SV=3 18 177 4.0E-07
sp|Q2TBH7|RAB4A_BOVIN Ras-related protein Rab-4A OS=Bos taurus GN=RAB4A PE=2 SV=3 18 130 4.0E-07
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 18 177 4.0E-07
sp|Q5EB77|RAB18_RAT Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1 18 177 4.0E-07
sp|P35293|RAB18_MOUSE Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 18 177 4.0E-07
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 18 110 4.0E-07
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 18 110 4.0E-07
sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 14 93 4.0E-07
sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 14 93 4.0E-07
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 5 101 5.0E-07
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 5 101 5.0E-07
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 18 104 5.0E-07
sp|P51146|RAB4B_RAT Ras-related protein Rab-4B OS=Rattus norvegicus GN=Rab4b PE=2 SV=1 18 130 5.0E-07
sp|Q91ZR1|RAB4B_MOUSE Ras-related protein Rab-4B OS=Mus musculus GN=Rab4b PE=1 SV=2 18 130 5.0E-07
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 18 110 5.0E-07
sp|P61018|RAB4B_HUMAN Ras-related protein Rab-4B OS=Homo sapiens GN=RAB4B PE=1 SV=1 18 130 5.0E-07
sp|P61017|RAB4B_CANLF Ras-related protein Rab-4B OS=Canis lupus familiaris GN=RAB4B PE=2 SV=1 18 130 5.0E-07
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 18 110 5.0E-07
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 18 130 5.0E-07
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 18 130 5.0E-07
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 18 130 5.0E-07
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 6 130 5.0E-07
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 18 182 5.0E-07
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 18 130 6.0E-07
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 18 177 6.0E-07
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 18 177 6.0E-07
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 18 110 6.0E-07
sp|O13876|YPT4_SCHPO GTP-binding protein ypt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt4 PE=3 SV=1 18 130 6.0E-07
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 18 177 6.0E-07
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 17 130 6.0E-07
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 18 101 7.0E-07
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 18 130 7.0E-07
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 18 101 7.0E-07
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 18 131 8.0E-07
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 18 130 9.0E-07
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 18 130 1.0E-06
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 18 130 1.0E-06
sp|Q20907|GPA8_CAEEL Guanine nucleotide-binding protein alpha-8 subunit OS=Caenorhabditis elegans GN=gpa-8 PE=2 SV=1 44 166 1.0E-06
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 17 130 1.0E-06
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 17 130 1.0E-06
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 17 130 1.0E-06
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 17 130 1.0E-06
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 18 93 1.0E-06
sp|P27044|GNAI1_XENLA Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Xenopus laevis GN=gnai1 PE=2 SV=3 44 161 1.0E-06
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 17 130 1.0E-06
sp|Q55EG6|RABT1_DICDI Ras-related protein RabT1 OS=Dictyostelium discoideum GN=rabT1 PE=3 SV=1 18 142 1.0E-06
sp|P36019|YPT53_YEAST GTP-binding protein YPT53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT53 PE=1 SV=1 18 182 1.0E-06
sp|P30682|GNAI_LYMST Guanine nucleotide-binding protein G(i) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3 44 161 1.0E-06
sp|P51876|GNAI_PLATR Guanine nucleotide-binding protein G(i) subunit alpha OS=Planorbella trivolvis PE=2 SV=2 44 161 1.0E-06
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 5 101 1.0E-06
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 5 101 1.0E-06
sp|P36410|RAB14_DICDI Ras-related protein Rab-14 OS=Dictyostelium discoideum GN=rab14 PE=1 SV=2 18 170 2.0E-06
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 17 130 2.0E-06
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 5 101 2.0E-06
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 5 101 2.0E-06
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 5 101 2.0E-06
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 18 110 2.0E-06
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 18 130 2.0E-06
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 17 130 2.0E-06
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 5 101 2.0E-06
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 17 130 2.0E-06
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 18 110 2.0E-06
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 17 130 2.0E-06
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 17 130 2.0E-06
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 17 130 2.0E-06
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 16 132 2.0E-06
sp|P41776|GNAI_HOMAM Guanine nucleotide-binding protein G(i) subunit alpha OS=Homarus americanus PE=2 SV=2 44 130 2.0E-06
sp|Q99P58|RB27B_MOUSE Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 18 182 2.0E-06
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 10 130 2.0E-06
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 10 130 3.0E-06
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 10 130 3.0E-06
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 10 130 3.0E-06
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 10 130 3.0E-06
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 18 101 3.0E-06
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 18 130 3.0E-06
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 18 101 3.0E-06
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 14 168 3.0E-06
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 18 104 3.0E-06
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 18 101 3.0E-06
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 18 101 3.0E-06
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 18 182 3.0E-06
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 18 130 3.0E-06
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 18 98 4.0E-06
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 19 179 4.0E-06
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 18 98 4.0E-06
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 18 98 4.0E-06
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 17 130 4.0E-06
sp|Q9NX57|RAB20_HUMAN Ras-related protein Rab-20 OS=Homo sapiens GN=RAB20 PE=1 SV=1 17 141 5.0E-06
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 14 168 5.0E-06
sp|Q05976|RB18A_LYMST Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1 24 166 5.0E-06
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 18 182 5.0E-06
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 3 130 6.0E-06
sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 17 130 6.0E-06
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 18 93 6.0E-06
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 18 93 6.0E-06
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 18 110 6.0E-06
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 10 130 6.0E-06
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 18 130 7.0E-06
sp|P51875|GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans GN=goa-1 PE=1 SV=3 44 161 7.0E-06
sp|P10825|GNAO_XENLA Guanine nucleotide-binding protein G(o) subunit alpha OS=Xenopus laevis GN=gna0 PE=2 SV=5 44 166 7.0E-06
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 18 93 7.0E-06
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 19 130 8.0E-06
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 18 93 8.0E-06
sp|P08754|GNAI3_HUMAN Guanine nucleotide-binding protein G(k) subunit alpha OS=Homo sapiens GN=GNAI3 PE=1 SV=3 44 130 9.0E-06
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 18 130 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045580
MGANLSKALGKLFGSKEMRLLMLGLDAAGKTTILYKLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIR
PLWRHYYTGTQGLVFVVDSQDRERIDEAKHELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHKMRD
RSWYVHPSCATTGEGLFEGLQWLSQNVKKRQQ*
Coding >AgabiH97|045580
ATGGGTGCCAATCTATCAAAGGCTTTAGGCAAGCTCTTTGGCAGCAAGGAGATGCGACTCTTAATGCTCGGCCTC
GATGCCGCCGGAAAAACAACCATCCTCTACAAGCTCAAGTTGAACCAGTCTGTCACGACGATTCCGACAGTTGGT
TTCAACGTGGAGACCGTGACATACAAGAACGTCAAGTTCAACGTCTGGGACGTTGGTGGCCAGGACAAGATCCGC
CCCCTCTGGAGACATTACTACACCGGCACCCAAGGCCTCGTGTTTGTTGTCGACAGCCAAGATAGGGAACGTATT
GATGAGGCCAAACATGAGCTTCACCGGATATTGAGTGACAGGGAAATGAAGGAATGTTTACTGCTCGTGTTCGCA
AACAAACAAGATTTACCTGGAGCCATGTCACCAGCCGAGGTCACGGAGAAGCTCGGGCTTCATAAAATGCGGGAC
CGTTCCTGGTATGTACACCCGAGCTGTGCAACCACGGGGGAGGGTCTATTCGAGGGTCTGCAATGGCTCTCGCAG
AACGTCAAGAAACGACAGCAGTGA
Transcript >AgabiH97|045580
ATGGGTGCCAATCTATCAAAGGCTTTAGGCAAGCTCTTTGGCAGCAAGGAGATGCGACTCTTAATGCTCGGCCTC
GATGCCGCCGGAAAAACAACCATCCTCTACAAGCTCAAGTTGAACCAGTCTGTCACGACGATTCCGACAGTTGGT
TTCAACGTGGAGACCGTGACATACAAGAACGTCAAGTTCAACGTCTGGGACGTTGGTGGCCAGGACAAGATCCGC
CCCCTCTGGAGACATTACTACACCGGCACCCAAGGCCTCGTGTTTGTTGTCGACAGCCAAGATAGGGAACGTATT
GATGAGGCCAAACATGAGCTTCACCGGATATTGAGTGACAGGGAAATGAAGGAATGTTTACTGCTCGTGTTCGCA
AACAAACAAGATTTACCTGGAGCCATGTCACCAGCCGAGGTCACGGAGAAGCTCGGGCTTCATAAAATGCGGGAC
CGTTCCTGGTATGTACACCCGAGCTGTGCAACCACGGGGGAGGGTCTATTCGAGGGTCTGCAATGGCTCTCGCAG
AACGTCAAGAAACGACAGCAGTGA
Gene >AgabiH97|045580
ATGGGTGCCAATCTATCAAAGGCTTTAGGTGCGTTCTCCTGAGCTGACCCGCCCAACCACACCTCACACACCTGC
CCAATAGGCAAGCTCTTTGGCAGCAAGGAGATGCGACTCTTAATGCTCGGCCTCGATGCCGCCGGAAAAACAAGT
CAGCACGCTCCATTCTTCCCGCTTCACCCGCTTACCCCATTGCCTCACCAGCCATCCTCTACAAGCTCAAGTTGA
ACCAGTCTGTCACGACGATTCCGACAGGTGTCATCCCTTTCTTTCCCCACTAACGCTTATACTCAACATGAACAC
AGTTGGTTTCAACGTGGAGACCGTGACATACAAGAACGTCAAGTTCAACGTCTGGGACGTTGGTGGCCAGGACAA
GATCCGCCCCCTCTGGAGACATTACTACACCGGCACCCAAGGCCTCGTGTTTGTTGTCGACAGCCAAGATAGGGA
ACGTATTGATGAGGCCAAACATGAGCTTCACCGGATATTGAGTGACAGGGAAATGAAGGAATGTTTACTGCTCGT
GTTCGCAAACAAACAAGATTTACCTGGAGGTAACACATTGTTGCCCTTTCCGCTTCCCCTGAACTGAATCTCGCC
GTTAGCCATGTCACCAGCCGAGGTCACGGAGAAGCTCGGGCTTCATAAAATGCGGGACCGTTCCTGGTATGTACA
CCCGAGGTATGTGCATGTTTTATTTCGGTCTGCAGCGGCTAACATGACATGGGTAATCAGCTGTGCAACCACGGG
GGAGGGTCTATTCGAGGGTCTGCAATGGCTCTCGCAGAACGTCAAGAAACGACAGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail