Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045560
Gene name
Locationscaffold_2:1735310..1736845
Strand-
Gene length (bp)1535
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 6.8E-16 154 188
PF00627 UBA UBA/TS-N domain 6.1E-13 362 397
PF00240 ubiquitin Ubiquitin family 3.1E-21 3 73
PF09280 XPC-binding XPC-binding domain 1.4E-19 282 337
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 1.2E-08 1 69

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 401 2.0E-73
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 404 6.0E-68
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 404 6.0E-67
sp|Q84L31|RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana GN=RAD23C PE=1 SV=2 1 399 1.0E-65
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 404 2.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 401 2.0E-73
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 404 6.0E-68
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 404 6.0E-67
sp|Q84L31|RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana GN=RAD23C PE=1 SV=2 1 399 1.0E-65
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 404 2.0E-64
sp|Q40742|RAD23_ORYSJ Probable ubiquitin receptor RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 1 404 2.0E-64
sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 1 404 1.0E-61
sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 1 404 1.0E-61
sp|Q84L32|RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana GN=RAD23A PE=1 SV=2 1 404 4.0E-61
sp|Q84L30|RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana GN=RAD23D PE=1 SV=2 1 404 6.0E-60
sp|P32628|RAD23_YEAST UV excision repair protein RAD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD23 PE=1 SV=1 1 403 7.0E-59
sp|P54726|RD23A_MOUSE UV excision repair protein RAD23 homolog A OS=Mus musculus GN=Rad23a PE=1 SV=2 3 404 2.0E-58
sp|A3KMV2|RD23A_BOVIN UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1 3 404 2.0E-54
sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens GN=RAD23A PE=1 SV=1 3 404 2.0E-53
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 144 399 1.0E-19
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 1 75 9.0E-11
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 1 76 6.0E-09
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 3 55 1.0E-07
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 3 55 1.0E-07
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 3 55 1.0E-07
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 3 55 2.0E-07
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 3 55 2.0E-07
sp|O65381|RUB3_ARATH NEDD8-like protein RUB3 OS=Arabidopsis thaliana GN=RUB3 PE=2 SV=1 1 72 2.0E-07
sp|Q93725|NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans GN=ned-8 PE=1 SV=1 1 55 3.0E-07
sp|Q9VJ33|NEDD8_DROME NEDD8 OS=Drosophila melanogaster GN=Nedd8 PE=1 SV=1 1 72 3.0E-07
sp|Q4PLJ0|NEDD8_RABIT NEDD8 OS=Oryctolagus cuniculus GN=NEDD8 PE=3 SV=1 1 55 5.0E-07
sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens GN=NEDD8 PE=1 SV=1 1 55 5.0E-07
sp|P61282|NEDD8_BOVIN NEDD8 OS=Bos taurus GN=NEDD8 PE=3 SV=1 1 55 5.0E-07
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 1 71 7.0E-07
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 1 71 7.0E-07
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 1 71 7.0E-07
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 1 71 7.0E-07
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 1 71 7.0E-07
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 1 71 7.0E-07
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 1 71 7.0E-07
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 1 71 7.0E-07
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 1 71 7.0E-07
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 1 71 7.0E-07
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 1 71 7.0E-07
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 1 71 7.0E-07
sp|O14399|UBL1_SCHPO Ubiquitin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubl1 PE=3 SV=1 1 58 9.0E-07
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 1 71 1.0E-06
sp|Q71UE8|NEDD8_RAT NEDD8 OS=Rattus norvegicus GN=Nedd8 PE=1 SV=1 1 55 1.0E-06
sp|P29595|NEDD8_MOUSE NEDD8 OS=Mus musculus GN=Nedd8 PE=1 SV=2 1 55 1.0E-06
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 1 71 2.0E-06
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 1 71 2.0E-06
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 1 71 2.0E-06
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 1 71 2.0E-06
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 1 64 3.0E-06
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 1 71 4.0E-06
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 1 86 4.0E-06
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 1 71 6.0E-06
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 1 71 6.0E-06
sp|Q9NIF3|UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum GN=ubqln PE=1 SV=1 1 63 6.0E-06
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 1 71 7.0E-06
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 1 71 7.0E-06
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 1 71 7.0E-06
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 1 71 7.0E-06
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 1 71 7.0E-06
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 1 71 7.0E-06
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 1 71 7.0E-06
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 1 71 8.0E-06
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 1 71 8.0E-06
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 1 71 9.0E-06
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 1 71 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003684 damaged DNA binding Yes
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:0005515 protein binding Yes
GO:0006289 nucleotide-excision repair Yes
GO:0044248 cellular catabolic process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0019538 protein metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0030163 protein catabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0006259 DNA metabolic process No
GO:0033554 cellular response to stress No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0044237 cellular metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0006950 response to stress No
GO:0006281 DNA repair No
GO:0010498 proteasomal protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0050896 response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003677 DNA binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045560
MKITVKTTQQKVFQIDIEPTDTIGSLKAKIESAHNHPAPTQKIIYSGKILSDDKTIESCGVKEKDFFVLMVAKPK
PTPTPKPEAPAAPTTAEPTPPSSTSPATTTTPSHAETTETSSQPSPLPPPTTTSTSSTSSTEPATLGDGSGFLTG
AALQTTIQNMMEMGFDREQVLRALRASYNNPDRAVEYLMTGIPAHLEAEAAGPPRTSSTTQSNPAAPSAPQSNSP
AAPAPAPATAPAAAAPPANQPQNLFQLAQQQQTGGGGGAAAGMGGMGGMGGMGAPDLAALAANPQIQQLREIVRQ
NPALIQPLIQQLAAQNPQMAQALAANPDMLLQLLGAGEGDEEGGPEGEVPPGAQVISVTVEEREAIARLEALGFP
RHAVLEAYFACDKNEELAANYLFEGHFDD*
Coding >AgabiH97|045560
ATGAAGATCACCGTCAAAACCACCCAGCAAAAAGTCTTCCAGATAGACATAGAACCCACAGACACCATCGGCAGC
CTCAAGGCTAAAATCGAGTCTGCTCACAACCACCCCGCCCCAACCCAGAAGATCATCTACTCAGGTAAAATCCTT
TCAGATGACAAGACAATCGAGTCTTGTGGCGTAAAAGAAAAGGACTTTTTTGTCCTTATGGTCGCCAAGCCTAAA
CCGACGCCAACCCCAAAACCAGAAGCTCCAGCCGCCCCAACCACCGCCGAACCTACTCCTCCTTCCTCCACCTCC
CCGGCCACCACCACAACCCCTTCACACGCGGAGACAACAGAAACCTCATCTCAACCCTCACCACTACCACCGCCA
ACGACAACGTCAACGTCATCAACATCATCTACGGAACCTGCCACTCTTGGTGACGGCAGCGGGTTCCTTACTGGA
GCAGCTCTGCAGACTACCATTCAGAACATGATGGAAATGGGTTTCGATCGCGAACAGGTCCTTCGCGCCCTGCGT
GCTAGCTACAACAACCCAGATCGTGCAGTAGAATACCTCATGACGGGTATACCCGCTCATCTTGAAGCTGAAGCC
GCCGGCCCTCCACGGACATCCTCCACTACTCAATCCAATCCTGCTGCACCTTCTGCCCCCCAGTCAAATTCTCCT
GCCGCTCCTGCACCTGCACCTGCTACTGCCCCTGCCGCCGCTGCACCTCCAGCGAATCAACCTCAGAACCTGTTC
CAGTTAGCACAACAACAGCAAACGGGTGGTGGTGGGGGTGCCGCTGCTGGTATGGGCGGCATGGGTGGCATGGGT
GGTATGGGTGCTCCCGATCTCGCTGCTTTGGCAGCCAATCCCCAGATCCAGCAGCTCCGAGAAATTGTCAGGCAG
AATCCCGCGCTCATCCAACCGCTCATTCAACAGTTGGCAGCGCAGAATCCTCAAATGGCCCAGGCTCTTGCGGCC
AATCCTGACATGCTCCTGCAGCTCTTGGGCGCTGGCGAGGGTGACGAAGAAGGAGGCCCTGAAGGTGAGGTCCCC
CCGGGAGCCCAGGTGATTAGTGTGACTGTTGAAGAACGGGAAGCCATTGCTCGGTTGGAAGCACTAGGATTCCCT
CGACATGCTGTACTCGAGGCATACTTTGCCTGCGATAAGAATGAAGAGCTAGCCGCCAACTACCTTTTCGAGGGG
CATTTTGATGATTGA
Transcript >AgabiH97|045560
ATGAAGATCACCGTCAAAACCACCCAGCAAAAAGTCTTCCAGATAGACATAGAACCCACAGACACCATCGGCAGC
CTCAAGGCTAAAATCGAGTCTGCTCACAACCACCCCGCCCCAACCCAGAAGATCATCTACTCAGGTAAAATCCTT
TCAGATGACAAGACAATCGAGTCTTGTGGCGTAAAAGAAAAGGACTTTTTTGTCCTTATGGTCGCCAAGCCTAAA
CCGACGCCAACCCCAAAACCAGAAGCTCCAGCCGCCCCAACCACCGCCGAACCTACTCCTCCTTCCTCCACCTCC
CCGGCCACCACCACAACCCCTTCACACGCGGAGACAACAGAAACCTCATCTCAACCCTCACCACTACCACCGCCA
ACGACAACGTCAACGTCATCAACATCATCTACGGAACCTGCCACTCTTGGTGACGGCAGCGGGTTCCTTACTGGA
GCAGCTCTGCAGACTACCATTCAGAACATGATGGAAATGGGTTTCGATCGCGAACAGGTCCTTCGCGCCCTGCGT
GCTAGCTACAACAACCCAGATCGTGCAGTAGAATACCTCATGACGGGTATACCCGCTCATCTTGAAGCTGAAGCC
GCCGGCCCTCCACGGACATCCTCCACTACTCAATCCAATCCTGCTGCACCTTCTGCCCCCCAGTCAAATTCTCCT
GCCGCTCCTGCACCTGCACCTGCTACTGCCCCTGCCGCCGCTGCACCTCCAGCGAATCAACCTCAGAACCTGTTC
CAGTTAGCACAACAACAGCAAACGGGTGGTGGTGGGGGTGCCGCTGCTGGTATGGGCGGCATGGGTGGCATGGGT
GGTATGGGTGCTCCCGATCTCGCTGCTTTGGCAGCCAATCCCCAGATCCAGCAGCTCCGAGAAATTGTCAGGCAG
AATCCCGCGCTCATCCAACCGCTCATTCAACAGTTGGCAGCGCAGAATCCTCAAATGGCCCAGGCTCTTGCGGCC
AATCCTGACATGCTCCTGCAGCTCTTGGGCGCTGGCGAGGGTGACGAAGAAGGAGGCCCTGAAGGTGAGGTCCCC
CCGGGAGCCCAGGTGATTAGTGTGACTGTTGAAGAACGGGAAGCCATTGCTCGGTTGGAAGCACTAGGATTCCCT
CGACATGCTGTACTCGAGGCATACTTTGCCTGCGATAAGAATGAAGAGCTAGCCGCCAACTACCTTTTCGAGGGG
CATTTTGATGATTGA
Gene >AgabiH97|045560
ATGAAGATCACCGTCAAAACCACCCAGCAAAAAGTCTTCCAGGTATTTCCCCTTCTGCTCATCGCACCGCACAGC
GAGCAGACCTCTTTTTAGATAGACATAGAACCCACAGACACCATCGGCAGCCTCAAGGCTAAAATCGAGTCTGCT
CACAACCACCCCGCCCCAACCCAGAAGATCATCTACTCAGGTGCGCCATCTTTCGTCCCTTCTCCTCGCCGTTCT
ATTCACCATCCCGCCACAGGTAAAATCCTTTCAGATGACAAGACAATCGAGTCTTGTGGCGTAAAAGAAAAGGAC
TTTTTTGTCCTTATGGTCGCCAAGGTATCTCTTCAACTCTCCGTCGCTTTCTCTATCCTAACCCCGTTTCTTTCA
GCCTAAACCGACGCCAACCCCAAAACCAGAAGCTCCAGCCGCCCCAACCACCGCCGAACCTACTCCTCCTTCCTC
CACCTCCCCGGCCACCACCACAACCCCTTCACACGCGGAGACAACAGAAACCTCATCTCAACCCTCACCACTACC
ACCGCCAACGACAACGTCAACGTCATCAACATCATCTACGGAACCTGCCACTCTTGGTGACGGCAGCGGGTTCCT
TACTGGAGCAGCTCTGCAGACTACCATTCAGAACATGATGGAAATGGGTTTCGATCGCGAACAGGTCCTTCGCGC
CCTGCGTGCTAGCTACAACAACCCAGATCGTGCAGTAGAATACCTCATGACGGTGAGTTATTAAATCATATCTCG
AAGATAACGTTACCTGATATCGCCGAAAAGGGTATACCCGCTCATCTTGAAGCTGAAGCCGCCGGCCCTCCACGG
ACATCCTCCACTACTCAATCCAATCCTGCTGCACCTTCTGCCCCCCAGTCAAATTCTCCTGCCGCTCCTGCACCT
GCACCTGCTACTGCCCCTGCCGCCGCTGCACCTCCAGCGAATCAACCTCAGAACCTGTTCCAGGTAAGTTTGGAG
TTCCATATGTTTCGCTGAACTTGACTCAGAGTCCCTGTACTTAGTTAGCACAACAACAGCAAACGGGTGGTGGTG
GGGGTGCCGCTGCTGGTATGGGCGGCATGGGTGGCATGGGTGGTATGGGTGCTCCCGATCTCGCTGCTTTGGCAG
CCAATCCCCAGATCCAGCAGCTCCGAGAAATTGTCAGGCAGAATCCCGCGCTCATCCAACCGCTCATTCAACAGT
TGGCAGCGCAGAATCCTCAAATGGCCCAGGCTCTTGCGGCCAATCCTGACATGCTCCTGCAGCTCTTGGGCGCTG
GCGAGGGTGACGAAGAAGGAGGCCCTGAAGGTGAGGTCCCCCCGGGAGCCCAGGTGATTAGTGTGACTGTTGAAG
AACGGGAAGCCATTGCTCGGGTAAGCCAGATTTAGATTTACTTTTTGTTCCACTTTTAACCCCAGTGGGAATAGT
TGGAAGCACTAGGATTCCCTCGACATGCTGTACTCGAGGCATACTTTGCCTGCGATAAGAATGAAGAGCTAGCCG
CCAACTACCTTTTCGAGGGGCATTTTGATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail