Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045550
Gene name
Locationscaffold_2:1732420..1734952
Strand-
Gene length (bp)2532
Transcript length (bp)2139
Coding sequence length (bp)2139
Protein length (aa) 713

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01735 PLA2_B Lysophospholipase catalytic domain 1.4E-96 103 609

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XZV8|PLB3_ASPFC Lysophospholipase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plb3 PE=1 SV=1 8 609 3.0E-89
sp|P0C958|PLB3_ASPFU Lysophospholipase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plb3 PE=2 SV=1 8 609 3.0E-89
sp|P0C957|PLB1_ASPFU Lysophospholipase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plb1 PE=2 SV=1 15 609 8.0E-88
sp|B0Y665|PLB1_ASPFC Lysophospholipase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plb1 PE=1 SV=1 15 609 8.0E-88
sp|Q9UVX1|PLB3_CANAX Lysophospholipase 3 OS=Candida albicans GN=PLB3 PE=3 SV=2 25 608 2.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XZV8|PLB3_ASPFC Lysophospholipase 3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plb3 PE=1 SV=1 8 609 3.0E-89
sp|P0C958|PLB3_ASPFU Lysophospholipase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plb3 PE=2 SV=1 8 609 3.0E-89
sp|P0C957|PLB1_ASPFU Lysophospholipase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plb1 PE=2 SV=1 15 609 8.0E-88
sp|B0Y665|PLB1_ASPFC Lysophospholipase 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plb1 PE=1 SV=1 15 609 8.0E-88
sp|Q9UVX1|PLB3_CANAX Lysophospholipase 3 OS=Candida albicans GN=PLB3 PE=3 SV=2 25 608 2.0E-85
sp|Q9P8P4|PLB2_ASPFU Lysophospholipase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plb2 PE=3 SV=2 32 609 4.0E-84
sp|B0Y1M7|PLB2_ASPFC Lysophospholipase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plb2 PE=3 SV=1 32 609 4.0E-84
sp|Q8TG07|PLB1_CANGA Lysophospholipase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PLB1 PE=3 SV=2 32 625 2.0E-83
sp|Q08108|PLB3_YEAST Lysophospholipase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLB3 PE=3 SV=1 32 609 6.0E-81
sp|O42790|PLB_NEUCR Lysophospholipase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lpl PE=3 SV=2 15 609 1.0E-78
sp|O59863|PLB_KLULA Lysophospholipase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PLB PE=1 SV=1 32 609 2.0E-78
sp|P39457|PLB1_PENCH Lysophospholipase (Fragment) OS=Penicillium chrysogenum PE=1 SV=1 32 628 3.0E-78
sp|P39105|PLB1_YEAST Lysophospholipase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLB1 PE=1 SV=2 6 609 2.0E-77
sp|Q8TG06|PLB2_CANGA Lysophospholipase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PLB2 PE=3 SV=2 32 623 6.0E-77
sp|Q03674|PLB2_YEAST Lysophospholipase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLB2 PE=1 SV=1 2 609 2.0E-76
sp|Q11121|PLB1_TORDE Lysophospholipase OS=Torulaspora delbrueckii PE=1 SV=1 32 639 1.0E-75
sp|Q9UWF6|PLB1_CANAL Lysophospholipase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PLB1 PE=1 SV=1 32 609 1.0E-71
sp|D4ANV2|PLB1_ARTBC Lysophospholipase ARB_05919 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05919 PE=1 SV=1 32 660 1.0E-71
sp|O13857|PLB2_SCHPO Putative lysophospholipase C1A6.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.03c PE=3 SV=3 26 609 6.0E-70
sp|Q9P327|PLB4_SCHPO Putative lysophospholipase C977.09c/C1348.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.09c PE=2 SV=1 9 609 2.0E-69
sp|Q9Y7N6|PLB5_SCHPO Putative lysophospholipase C1450.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.09c PE=3 SV=3 32 609 3.0E-63
sp|O93795|PLB2_CANAX Lysophospholipase 2 OS=Candida albicans GN=PLB2 PE=3 SV=1 38 609 5.0E-63
sp|P78854|PLB1_SCHPO Lysophospholipase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plb1 PE=2 SV=2 32 608 5.0E-62
sp|Q9UTH5|PLB6_SCHPO Probable lysophospholipase C1786.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1786.02 PE=3 SV=1 2 609 2.0E-61
sp|Q9P8P2|PLB1_CRYNH Phospholipase B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PLB1 PE=1 SV=2 101 608 3.0E-56
sp|P0CP74|PLB1_CRYNJ Phospholipase B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PLB1 PE=3 SV=1 32 608 4.0E-56
sp|P0CP75|PLB1_CRYNB Phospholipase B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PLB1 PE=3 SV=1 32 608 4.0E-56
sp|P53541|SPO1_YEAST Putative meiotic phospholipase SPO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO1 PE=1 SV=2 204 608 8.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0004620 phospholipase activity Yes
GO:0009395 phospholipid catabolic process Yes
GO:0016787 hydrolase activity No
GO:0016042 lipid catabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044242 cellular lipid catabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0044248 cellular catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0008152 metabolic process No
GO:1901575 organic substance catabolic process No
GO:0019637 organophosphate metabolic process No
GO:0016298 lipase activity No
GO:0003674 molecular_function No
GO:0006644 phospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 645 667 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045550
MFRAFLLLSSLLVSFSVQETPPDPSQDSITDYAPQVNVECPDISKAPLIRTWDTNNQSIHPQEEEYLKKRAEQVL
PQAWNDWLGNGSRMGYDLSDHNISWPKIGLALPGGGLRAALFAAGSLSGLDARNETAKNAGTGGLLQVASYISGL
SGGSWATGSMYFNDFPTLHDLVLGIGDNLGGWALDFDFATPDGPNLFSTQNQAWFGSLLWSVRSKADKGIDTSLT
DPWSRIISYHFLNQTTRSNFFTNDTTHGAGQLWSKTSQIPSVQQFKTPFPIIVADARPVGSNLTTTLDLQATVYE
ITPVEFASFDPSLSAGMNMTYAGTHLSNGFPDNGTACVTGFDQVGFMMGTSASLFNQILDFASNAIQGWSQSDTD
GLLYILGEQLKEVRTRADDVANWPNPFKGIKPDTFQDANAAWLELIDGSSNLENIPYNPLFIKSRGLDVIVTIEG
SADDVHNFPNGTGNIFTKERLSTILKDTHQPFPPIPSSIDEFVSTGVNGRATFFGCDPPNSSAYPMVVYLPNAPP
INGDDPITNTATFQLVYTLKHVSLFLDSAQKLVIEGFTPNANTPDPNFGACLQCAVFDRARMKATPSFDRSDICK
KCFQQYCFDPENPPSRSELPNRKFDFVDPDPQGLASFLSRNKFKFLGGVIGLVVLIILLVVGLICWRKRRNKIFY
KKLGDNYRKDAFEMNSHPPPYQGGGQMYDLPNHQGQL*
Coding >AgabiH97|045550
ATGTTCCGCGCGTTCCTTTTGCTTTCCTCCCTTCTCGTATCTTTTTCCGTTCAAGAAACACCTCCAGACCCTTCG
CAGGACTCTATAACTGATTATGCTCCACAGGTCAATGTAGAGTGTCCTGACATCTCGAAGGCTCCCCTAATTCGT
ACATGGGATACAAATAACCAATCTATCCACCCCCAAGAAGAGGAATATCTGAAAAAACGCGCAGAACAAGTCCTG
CCTCAAGCTTGGAATGACTGGCTTGGAAATGGATCTCGTATGGGCTATGACCTGTCCGACCACAACATCAGCTGG
CCGAAGATTGGCTTAGCGCTTCCCGGTGGTGGTCTGCGCGCCGCCCTGTTTGCTGCAGGTTCTTTGAGTGGTTTG
GATGCTAGGAATGAGACCGCCAAAAATGCTGGCACGGGCGGGTTGTTGCAAGTTGCGTCCTATATCTCGGGCCTC
TCGGGCGGTTCTTGGGCGACAGGATCCATGTACTTTAATGATTTTCCTACTCTTCATGACCTAGTCCTCGGCATT
GGCGACAACCTCGGCGGTTGGGCTTTGGATTTTGATTTTGCTACACCTGATGGTCCCAACCTTTTCTCCACGCAG
AACCAGGCATGGTTTGGAAGTCTCCTCTGGAGCGTCAGGTCCAAGGCAGACAAGGGAATTGATACCAGTTTGACA
GATCCCTGGTCAAGGATAATCTCGTACCATTTTCTGAATCAAACCACGAGGAGTAACTTTTTCACCAATGATACT
ACTCATGGTGCCGGTCAGCTCTGGTCAAAGACATCACAGATACCTTCAGTTCAGCAATTCAAAACTCCGTTTCCT
ATTATTGTCGCTGATGCACGTCCGGTTGGATCGAACTTGACTACGACCTTGGACCTGCAGGCCACCGTGTATGAG
ATAACTCCAGTGGAATTTGCCTCGTTCGACCCTAGTTTATCGGCAGGGATGAATATGACATACGCAGGGACGCAT
CTCTCCAATGGGTTCCCCGACAACGGCACAGCTTGCGTAACTGGGTTTGATCAGGTTGGCTTCATGATGGGAACC
AGTGCAAGTTTATTCAATCAAATTTTGGATTTCGCCAGTAACGCGATCCAGGGCTGGTCACAATCTGATACAGAT
GGGTTGTTATACATTCTCGGCGAACAATTGAAAGAAGTGAGAACGAGGGCCGATGACGTTGCCAATTGGCCGAAC
CCTTTCAAAGGGATAAAACCAGACACATTCCAAGACGCCAATGCAGCTTGGTTAGAACTCATCGATGGCTCGTCG
AATTTAGAAAACATACCATATAATCCTCTATTCATAAAAAGTCGGGGGCTAGATGTCATTGTAACAATCGAGGGT
AGTGCTGATGATGTCCATAATTTCCCCAACGGCACTGGTAACATATTCACAAAGGAGAGACTTTCAACGATTTTG
AAGGACACACATCAACCGTTTCCCCCCATTCCAAGTTCAATAGACGAGTTTGTTTCAACTGGTGTCAATGGGCGA
GCTACATTTTTTGGCTGCGATCCGCCAAATTCTTCTGCTTATCCCATGGTCGTCTACCTTCCAAATGCTCCACCT
ATCAATGGCGACGATCCAATTACCAACACGGCTACATTTCAACTCGTTTACACCCTTAAACACGTCTCTCTGTTC
TTGGATAGTGCCCAGAAACTTGTGATTGAAGGTTTCACGCCCAATGCCAATACGCCGGACCCAAATTTTGGTGCT
TGTCTGCAATGTGCCGTCTTTGATAGGGCGCGAATGAAAGCGACGCCAAGTTTTGACCGTTCTGACATTTGTAAA
AAGTGTTTTCAACAGTATTGCTTTGATCCAGAAAACCCACCTAGTCGGAGTGAACTGCCAAATCGCAAATTTGAT
TTCGTAGATCCAGATCCTCAGGGTTTGGCGAGCTTTCTCTCCAGGAACAAGTTCAAATTTTTGGGCGGAGTGATT
GGGCTCGTGGTCTTGATTATTTTGCTCGTTGTTGGACTAATTTGCTGGAGGAAACGTCGAAATAAAATATTCTAC
AAAAAGCTGGGCGACAACTACCGGAAGGATGCATTTGAAATGAACTCTCATCCCCCACCGTATCAGGGAGGGGGG
CAAATGTACGACTTGCCCAATCATCAGGGTCAGCTATGA
Transcript >AgabiH97|045550
ATGTTCCGCGCGTTCCTTTTGCTTTCCTCCCTTCTCGTATCTTTTTCCGTTCAAGAAACACCTCCAGACCCTTCG
CAGGACTCTATAACTGATTATGCTCCACAGGTCAATGTAGAGTGTCCTGACATCTCGAAGGCTCCCCTAATTCGT
ACATGGGATACAAATAACCAATCTATCCACCCCCAAGAAGAGGAATATCTGAAAAAACGCGCAGAACAAGTCCTG
CCTCAAGCTTGGAATGACTGGCTTGGAAATGGATCTCGTATGGGCTATGACCTGTCCGACCACAACATCAGCTGG
CCGAAGATTGGCTTAGCGCTTCCCGGTGGTGGTCTGCGCGCCGCCCTGTTTGCTGCAGGTTCTTTGAGTGGTTTG
GATGCTAGGAATGAGACCGCCAAAAATGCTGGCACGGGCGGGTTGTTGCAAGTTGCGTCCTATATCTCGGGCCTC
TCGGGCGGTTCTTGGGCGACAGGATCCATGTACTTTAATGATTTTCCTACTCTTCATGACCTAGTCCTCGGCATT
GGCGACAACCTCGGCGGTTGGGCTTTGGATTTTGATTTTGCTACACCTGATGGTCCCAACCTTTTCTCCACGCAG
AACCAGGCATGGTTTGGAAGTCTCCTCTGGAGCGTCAGGTCCAAGGCAGACAAGGGAATTGATACCAGTTTGACA
GATCCCTGGTCAAGGATAATCTCGTACCATTTTCTGAATCAAACCACGAGGAGTAACTTTTTCACCAATGATACT
ACTCATGGTGCCGGTCAGCTCTGGTCAAAGACATCACAGATACCTTCAGTTCAGCAATTCAAAACTCCGTTTCCT
ATTATTGTCGCTGATGCACGTCCGGTTGGATCGAACTTGACTACGACCTTGGACCTGCAGGCCACCGTGTATGAG
ATAACTCCAGTGGAATTTGCCTCGTTCGACCCTAGTTTATCGGCAGGGATGAATATGACATACGCAGGGACGCAT
CTCTCCAATGGGTTCCCCGACAACGGCACAGCTTGCGTAACTGGGTTTGATCAGGTTGGCTTCATGATGGGAACC
AGTGCAAGTTTATTCAATCAAATTTTGGATTTCGCCAGTAACGCGATCCAGGGCTGGTCACAATCTGATACAGAT
GGGTTGTTATACATTCTCGGCGAACAATTGAAAGAAGTGAGAACGAGGGCCGATGACGTTGCCAATTGGCCGAAC
CCTTTCAAAGGGATAAAACCAGACACATTCCAAGACGCCAATGCAGCTTGGTTAGAACTCATCGATGGCTCGTCG
AATTTAGAAAACATACCATATAATCCTCTATTCATAAAAAGTCGGGGGCTAGATGTCATTGTAACAATCGAGGGT
AGTGCTGATGATGTCCATAATTTCCCCAACGGCACTGGTAACATATTCACAAAGGAGAGACTTTCAACGATTTTG
AAGGACACACATCAACCGTTTCCCCCCATTCCAAGTTCAATAGACGAGTTTGTTTCAACTGGTGTCAATGGGCGA
GCTACATTTTTTGGCTGCGATCCGCCAAATTCTTCTGCTTATCCCATGGTCGTCTACCTTCCAAATGCTCCACCT
ATCAATGGCGACGATCCAATTACCAACACGGCTACATTTCAACTCGTTTACACCCTTAAACACGTCTCTCTGTTC
TTGGATAGTGCCCAGAAACTTGTGATTGAAGGTTTCACGCCCAATGCCAATACGCCGGACCCAAATTTTGGTGCT
TGTCTGCAATGTGCCGTCTTTGATAGGGCGCGAATGAAAGCGACGCCAAGTTTTGACCGTTCTGACATTTGTAAA
AAGTGTTTTCAACAGTATTGCTTTGATCCAGAAAACCCACCTAGTCGGAGTGAACTGCCAAATCGCAAATTTGAT
TTCGTAGATCCAGATCCTCAGGGTTTGGCGAGCTTTCTCTCCAGGAACAAGTTCAAATTTTTGGGCGGAGTGATT
GGGCTCGTGGTCTTGATTATTTTGCTCGTTGTTGGACTAATTTGCTGGAGGAAACGTCGAAATAAAATATTCTAC
AAAAAGCTGGGCGACAACTACCGGAAGGATGCATTTGAAATGAACTCTCATCCCCCACCGTATCAGGGAGGGGGG
CAAATGTACGACTTGCCCAATCATCAGGGTCAGCTATGA
Gene >AgabiH97|045550
ATGTTCCGCGCGTTCCTTTTGCTTTCCTCCCTTCTCGTATCTTTTTCCGTTCAAGAAACACCTCCAGACCCTTCG
CAGGACTCTATAACTGATTATGCTCCACAGGTCAATGTAGAGTGTCCTGACATCTCGAAGGCTCCCCTAATTCGT
ACATGGGATACAAATAACCAATCTATCCACCCCCAAGAAGAGGAATATCTGAAAAAACGCGCAGAACAAGTCCTG
CCTCAAGCTTGGAATGACTGGCTTGGAAATGGATCTCGTATGGGCTATGACCTGTCCGACCACAACATCAGCTGG
CCGAAGATTGGCTTAGCGCTTCCCGGTGGTGGTCTGCGCGCCGCCCTGTTTGCTGCAGGTTCTTTGAGTGGTTTG
GATGCTAGGAATGAGACCGCCAAAAATGCTGGCACGGGCGGGTTGTTGCAAGTTGCGTCCTATATCTCGGGCCTC
TCGGGTTTGTACTGCCCTTATCACCGGCACAGGGCTGTGGCTCATCTGAAATTTAGGCGGTTCTTGGGCGACAGG
ATCCATGTACTTTAATGATTTTCCTACTCTTCATGACCTAGTCCTCGGCATTGGCGACAACCTCGGCGGTTGGGC
TTTGGATTTTGATTTTGCTACACCTGATGGTCCCAACCTTTTCTCCACGCAGAACCAGGCATGGTTTGGAAGTCT
CCTCTGGAGCGTCAGGTCCAAGGCAGACAAGGGAATGTAAATAAGGTTCCAGCTACTTCTCTGGTTATTCACATT
ACTGACATTCACGACCATTCAGTGATACCAGTTTGACAGATCCCTGGTCAAGGATAATCTCGTACCATTTTCTGA
ATCAAACCACGAGGAGTAACTTTTTCACCAATGATACTACTCATGGTGCCGGTCAGCTCTGGTCAAAGACATCAC
AGATACCTTCAGTTCAGCAATTCAAAACTCCGTTTCCTATTATTGTCGCTGATGCACGTCCGGTTGGATCGAACT
TGACTACGACCTTGGACCTGCAGGCCACCGTGTATGAGGTAGGGACCCTTTCCTGTGTTATTATATCTTCCTGAA
ACCTATCTTTAGATAACTCCAGTGGAATTTGCCTCGTTCGACCCTAGTTTATCGGCAGGGATGAATATGACATAC
GCAGGGACGCATCTCTCCAATGGGTTCCCCGACAACGGCACAGCTTGCGTAACTGGGTTTGATCAGGTTGGCTTC
ATGATGGGAACCAGTGCAAGTTTATTCAATGTCAGTCGCCAGCATGCTTGTCGCGACGAAAAGTGGCTGATGGAT
GTTTTTTTTATTACTAGCAAATTTTGGATTTCGCCAGTAACGCGATCCAGGGCTGGTCACAATCTGATACAGATG
GGTTGTTATACATTCTCGGCGAACAATTGAAAGAAGTGAGAACGAGGGCCGATGACGTTGCCAATTGGCCGAACC
CTTTCAAAGGGATAAAACCAGACACATTCCAAGACGCCAATGCAGCTTGGTTAGAACTCATCGATGGCTCGTCGA
ATTTAGAAAACATACCATATAATCCTCTATTCATAAAAAGTCGGGGGCTAGATGTCATTGTAACAATCGAGGGTA
GTGCTGATGATGTCCATAATTTCCCCAAGTGCGTTGTCTATAGATCTTCTCATCGTCATAAATCCTCATCCATTC
ACTCGCAGCGGCACTGGTAACATATTCACAAAGGAGAGACTTTCAACGATTTTGAAGGACACACATCAACCGTTT
CCCCCCATTCCAAGTTCAATAGACGAGTTTGTTTCAACTGGTGTCAATGGGCGAGCTACATTTTTTGGCTGCGAT
CCGCCAAATTCTTCTGCTTATCCCATGGTCGTCTACCTTCCAAATGCTCCACCTATCAATGGCGACGATCCAATT
ACCAAGTACGTCCTTGCATGCATGTCTGCGTCAATCAAACGTTTGACGTGATTATCAAAGCACGGCTACATTTCA
ACTCGTTTACACCCTTAAACACGTCTCTCTGTTCTTGGATAGTGCCCAGAAACTTGTGATTGAAGGTTTCACGCC
CAATGCCAATACGCCGGACCCAAATTTTGGTGCTTGTCTGCAATGTGCCGTCTTTGATAGGGCGCGAATGAAAGC
GACGCCAAGTTTTGACCGTTCTGACATTTGTAAAAAGTGTTTTCAACAGTATTGCTTTGATCCAGAAAACCCACC
TAGTCGGAGTGAACTGCCAAATCGCAAATTTGATTTCGTAGATCCAGATCCTCAGGGTTTGGCGAGCTTTCTCTC
CAGGAACAAGTTCAAATTTTTGGGCGGAGTGATTGGGCTCGTGGTCTTGATTATTTTGCTCGTTGTTGGACTGTG
GGTGTACAATTTATCCATGCTCTTCTAATGTGCTAACGGTGACTTTTTATCGACAGAATTTGCTGGAGGAAACGT
CGAAATAAAATATTCTACAAAAAGCTGGGCGACAACTACCGGAAGGATGCATTTGAAATGAACTCTCATCCCCCA
CCGTATCAGGGAGGGGGGCAAATGTACGACTTGCCCAATCATCAGGGTCAGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail