Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|045480
Gene name
Locationscaffold_2:1717802..1718673
Strand-
Gene length (bp)871
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02627 CMD Carboxymuconolactone decarboxylase family 6.9E-06 69 132

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0051920 peroxiredoxin activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|045480
MHLSSYLPLILSLIFFASAIPITKRDDNLPARVPYVFPEPGTNEIADEIRARRANGTLLALDGVLLNAPLVAQSW
NGVADVIRNHNTIPGAMRELFILRIAALNDAAYEWIQHEPVGRSEGLTSQQLRAIRLTPAFKGSSAEKVLGAEFT
AALDFCDWITKSVDVPDRVFKNLRRFLNDQQMVEATATNGFYAFVSRFVESLDVDGKVNTAVPIP*
Coding >AgabiH97|045480
ATGCACCTCTCATCGTATCTTCCCCTCATACTGAGTTTAATCTTCTTTGCGAGCGCAATACCAATCACCAAACGT
GATGATAACCTTCCTGCTCGTGTGCCGTATGTATTCCCTGAACCTGGGACAAACGAGATAGCAGATGAAATACGT
GCGAGGCGTGCTAACGGGACGCTACTTGCGTTGGATGGTGTCCTTCTAAATGCACCTCTCGTCGCTCAATCATGG
AACGGCGTTGCCGACGTTATCAGGAACCATAACACTATACCGGGAGCTATGCGCGAACTATTTATATTGCGTATC
GCCGCTTTGAACGATGCAGCTTATGAATGGATTCAGCATGAACCCGTCGGTCGCTCTGAAGGATTGACATCCCAA
CAGCTTAGGGCAATTCGATTGACCCCAGCATTCAAGGGTTCTAGTGCAGAAAAGGTACTCGGTGCTGAATTCACC
GCAGCTCTCGACTTTTGCGACTGGATCACCAAAAGCGTCGACGTTCCTGACCGCGTTTTCAAAAACCTTCGCCGA
TTCCTCAATGATCAACAAATGGTAGAAGCAACGGCGACTAACGGATTCTATGCTTTCGTTAGCCGGTTCGTCGAA
TCTCTCGACGTTGATGGAAAAGTCAACACAGCCGTGCCCATTCCGTAG
Transcript >AgabiH97|045480
ATGCACCTCTCATCGTATCTTCCCCTCATACTGAGTTTAATCTTCTTTGCGAGCGCAATACCAATCACCAAACGT
GATGATAACCTTCCTGCTCGTGTGCCGTATGTATTCCCTGAACCTGGGACAAACGAGATAGCAGATGAAATACGT
GCGAGGCGTGCTAACGGGACGCTACTTGCGTTGGATGGTGTCCTTCTAAATGCACCTCTCGTCGCTCAATCATGG
AACGGCGTTGCCGACGTTATCAGGAACCATAACACTATACCGGGAGCTATGCGCGAACTATTTATATTGCGTATC
GCCGCTTTGAACGATGCAGCTTATGAATGGATTCAGCATGAACCCGTCGGTCGCTCTGAAGGATTGACATCCCAA
CAGCTTAGGGCAATTCGATTGACCCCAGCATTCAAGGGTTCTAGTGCAGAAAAGGTACTCGGTGCTGAATTCACC
GCAGCTCTCGACTTTTGCGACTGGATCACCAAAAGCGTCGACGTTCCTGACCGCGTTTTCAAAAACCTTCGCCGA
TTCCTCAATGATCAACAAATGGTAGAAGCAACGGCGACTAACGGATTCTATGCTTTCGTTAGCCGGTTCGTCGAA
TCTCTCGACGTTGATGGAAAAGTCAACACAGCCGTGCCCATTCCGTAG
Gene >AgabiH97|045480
ATGCACCTCTCATCGTATCTTCCCCTCATACTGAGTTTAATCTTCTTTGCGAGCGCAATACCAATCACCAAACGT
GATGATAACCTTCCTGCTCGTGTGCCGTATGTATTCCCTGAACCTGGGACAAACGAGGTCAGCTAGCTAGTAATA
AAAGAGTATATCACGCCGACCTGACTAACCGAACCAGATAGCAGATGAAATACGTGCGAGGCGTGCTAACGGGAC
GCTACTTGCGTTGGATGGTGTCCTGTAAGAAAGTAACCATTCATAACTCGTCCTCCACTCATTAACATTGCTGCA
AAGTCTAAATGCACCTCTCGTCGCTCAATCATGGAACGGCGTTGCCGACGTTATCAGGAACCATAACACTATACC
GGGAGCTATGCGCGAACTATTTGTAGGTATCCTCGATAATAAAACGCTGGGCGTATGCTAATTATTCTTGAATTG
GTACAGATATTGCGTATCGCCGCTTTGAACGATGCAGCTTATGAATGGTATTTAGCCTTTGTTCTCAAAGAGCTT
TTTTCCTCTAAATTTGTTTTAAAACAGGATTCAGCATGAACCCGTCGGTCGCTCTGAAGGATTGACATCCCAACA
GCTTAGGGCAATTCGATTGACCCCAGCATTCAAGGGTTCTAGTGCAGAAAAGGTACTCGGTGCTGAATTCACCGC
AGCTCTCGACTTTTGCGACTGGATCACCAAAAGCGTCGACGTTCCTGACCGCGTTTTCAAAAACCTTCGCCGATT
CCTCAATGATCAACAAATGGTAGAAGCAACGGCGACTAACGGATTCTATGCTTTCGTTAGCCGGTTCGTCGAATC
TCTCGACGTTGATGGAAAAGTCAACACAGCCGTGCCCATTCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail