Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044810
Gene name
Locationscaffold_2:1571069..1572023
Strand-
Gene length (bp)954
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08284 RVP_2 Retroviral aspartyl protease 2.3E-11 32 134
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 5.6E-08 26 117
PF13650 Asp_protease_2 Aspartyl protease 9.1E-07 25 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 317 7.0E-18
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 317 7.0E-18
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 317 7.0E-18
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 317 7.0E-18
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 317 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 317 7.0E-18
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 317 7.0E-18
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 317 7.0E-18
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 317 7.0E-18
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 317 7.0E-18
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 317 7.0E-18
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 317 7.0E-18
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 30 317 7.0E-18
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 30 317 7.0E-18
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 317 7.0E-18
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 30 317 9.0E-18
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 316 2.0E-16
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 316 2.0E-16
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 108 314 1.0E-14
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 208 316 3.0E-13
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 312 2.0E-12
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 309 2.0E-11
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 261 317 5.0E-11
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 46 316 6.0E-11
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 17 310 2.0E-10
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 213 315 3.0E-10
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 213 310 6.0E-10
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 213 310 9.0E-10
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 213 310 6.0E-09
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 213 310 1.0E-08
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 201 314 2.0E-08
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 213 314 1.0E-06
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 133 2.0E-06
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 31 303 3.0E-06
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 211 302 4.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6645 0.5488 0.288 0.0551 0.2296 0.0788 0.0851 0.1306 0.0165 0.017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup62
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|203700
Agaricus bisporus var bisporus H39 AgabiH39|543800
Agaricus bisporus var bisporus H39 AgabiH39|541900
Agaricus bisporus var bisporus H39 AgabiH39|484000
Agaricus bisporus var bisporus H39 AgabiH39|482700
Agaricus bisporus var bisporus H39 AgabiH39|465600
Agaricus bisporus var bisporus H39 AgabiH39|458400
Agaricus bisporus var bisporus H39 AgabiH39|442600
Agaricus bisporus var bisporus H39 AgabiH39|440000
Agaricus bisporus var bisporus H39 AgabiH39|431100
Agaricus bisporus var bisporus H39 AgabiH39|423100
Agaricus bisporus var bisporus H39 AgabiH39|407200
Agaricus bisporus var bisporus H39 AgabiH39|397400
Agaricus bisporus var bisporus H39 AgabiH39|367300
Agaricus bisporus var bisporus H39 AgabiH39|471500
Agaricus bisporus var bisporus H39 AgabiH39|365700
Agaricus bisporus var bisporus H39 AgabiH39|366200
Agaricus bisporus var bisporus H39 AgabiH39|220000
Agaricus bisporus var bisporus H39 AgabiH39|223400
Agaricus bisporus var bisporus H39 AgabiH39|231200
Agaricus bisporus var bisporus H39 AgabiH39|240600
Agaricus bisporus var bisporus H39 AgabiH39|225300
Agaricus bisporus var bisporus H39 AgabiH39|303300
Agaricus bisporus var bisporus H39 AgabiH39|310900
Agaricus bisporus var bisporus H39 AgabiH39|337900
Agaricus bisporus var bisporus H39 AgabiH39|363700
Agaricus bisporus var bisporus H39 AgabiH39|364000
Agaricus bisporus var bisporus H39 AgabiH39|288000
Agaricus bisporus var bisporus H97 AgabiH97|048890
Agaricus bisporus var bisporus H97 AgabiH97|078540
Agaricus bisporus var bisporus H97 AgabiH97|051180
Agaricus bisporus var bisporus H97 AgabiH97|059850
Agaricus bisporus var bisporus H97 AgabiH97|059860
Agaricus bisporus var bisporus H97 AgabiH97|059920
Agaricus bisporus var bisporus H97 AgabiH97|060470
Agaricus bisporus var bisporus H97 AgabiH97|076080
Agaricus bisporus var bisporus H97 AgabiH97|078600
Agaricus bisporus var bisporus H97 AgabiH97|108240
Agaricus bisporus var bisporus H97 AgabiH97|082340
Agaricus bisporus var bisporus H97 AgabiH97|084900
Agaricus bisporus var bisporus H97 AgabiH97|107880
Agaricus bisporus var bisporus H97 AgabiH97|108080
Agaricus bisporus var bisporus H97 AgabiH97|110130
Agaricus bisporus var bisporus H97 AgabiH97|117630
Agaricus bisporus var bisporus H97 AgabiH97|118430
Agaricus bisporus var bisporus H97 AgabiH97|048870
Agaricus bisporus var bisporus H97 AgabiH97|082290
Agaricus bisporus var bisporus H97 AgabiH97|048860
Agaricus bisporus var bisporus H97 AgabiH97|013380
Agaricus bisporus var bisporus H97 AgabiH97|044800
Agaricus bisporus var bisporus H97 AgabiH97|012380
Agaricus bisporus var bisporus H97 AgabiH97|012440
Agaricus bisporus var bisporus H97 AgabiH97|012730
Agaricus bisporus var bisporus H97 AgabiH97|012750
Agaricus bisporus var bisporus H97 AgabiH97|012780
Agaricus bisporus var bisporus H97 AgabiH97|013210
Agaricus bisporus var bisporus H97 AgabiH97|119550
Agaricus bisporus var bisporus H97 AgabiH97|013410
Agaricus bisporus var bisporus H97 AgabiH97|044810 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|016500
Agaricus bisporus var bisporus H97 AgabiH97|020610
Agaricus bisporus var bisporus H97 AgabiH97|025620
Agaricus bisporus var bisporus H97 AgabiH97|025630
Agaricus bisporus var bisporus H97 AgabiH97|032380
Agaricus bisporus var bisporus H97 AgabiH97|039690
Agaricus bisporus var bisporus H97 AgabiH97|039850
Agaricus bisporus var bisporus H97 AgabiH97|040720
Agaricus bisporus var bisporus H97 AgabiH97|041140
Agaricus bisporus var bisporus H97 AgabiH97|016510
Agaricus bisporus var bisporus H97 AgabiH97|119560

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044810
MNNRYVVPQKRLGVQELEVKPLLTTTNGKKLKVSVMVDSGCTHTCIDEGLVKKKKIPMKKLEQPITCRNSDGTIA
GKKDITKFAKIDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGMIKFNRCPSSCSFPHTDISFEP
RIRRLQSNEDTEEKELDPTNPEDLPAYMKPFAHLFNRKNFDKLPERTEWDHEINFTENAPTEISSKVYSMTPLER
EELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNEITIKDKTPLPLISEVLDQLKDAKVFNK
LDVIWGYNNVRIREGDE*
Coding >AgabiH97|044810
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGTCATGGTCGACTCGGGATGCACACACACATGTATTGACGAAGGATTA
GTAAAGAAGAAGAAGATCCCGATGAAGAAATTGGAACAGCCGATCACATGCAGGAACTCAGACGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAATCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCTCATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGCCGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACTGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTTAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTAGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAAAAAGACGGATCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACA
ATCAAGGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAGCTCAAAGACGCCAAGGTTTTCAACAAA
TTGGACGTTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATGAATAG
Transcript >AgabiH97|044810
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGTCATGGTCGACTCGGGATGCACACACACATGTATTGACGAAGGATTA
GTAAAGAAGAAGAAGATCCCGATGAAGAAATTGGAACAGCCGATCACATGCAGGAACTCAGACGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAATCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCTCATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGCCGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACTGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTTAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTAGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAAAAAGACGGATCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACA
ATCAAGGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAGCTCAAAGACGCCAAGGTTTTCAACAAA
TTGGACGTTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATGAATAG
Gene >AgabiH97|044810
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGTCATGGTCGACTCGGGATGCACACACACATGTATTGACGAAGGATTA
GTAAAGAAGAAGAAGATCCCGATGAAGAAATTGGAACAGCCGATCACATGCAGGAACTCAGACGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAATCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCTCATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGCCGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACTGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTTAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTAGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAAAAAGACGGATCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACA
ATCAAGGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAGCTCAAAGACGCCAAGGTTTTCAACAAA
TTGGACGTTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail