Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|044810
Gene name
Locationscaffold_2:1571069..1572023
Strand-
Gene length (bp)954
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08284 RVP_2 Retroviral aspartyl protease 2.3E-11 32 134
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 5.6E-08 26 117
PF13650 Asp_protease_2 Aspartyl protease 9.1E-07 25 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 317 7.0E-18
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 317 7.0E-18
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 317 7.0E-18
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 317 7.0E-18
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 317 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 317 7.0E-18
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 317 7.0E-18
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 317 7.0E-18
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 317 7.0E-18
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 317 7.0E-18
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 317 7.0E-18
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 317 7.0E-18
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 30 317 7.0E-18
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 30 317 7.0E-18
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 317 7.0E-18
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 30 317 9.0E-18
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 316 2.0E-16
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 316 2.0E-16
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 108 314 1.0E-14
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 208 316 3.0E-13
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 312 2.0E-12
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 309 2.0E-11
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 261 317 5.0E-11
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 46 316 6.0E-11
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 17 310 2.0E-10
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 213 315 3.0E-10
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 213 310 6.0E-10
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 213 310 9.0E-10
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 213 310 6.0E-09
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 213 310 1.0E-08
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 201 314 2.0E-08
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 213 314 1.0E-06
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 133 2.0E-06
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 31 303 3.0E-06
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 211 302 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|044810
MNNRYVVPQKRLGVQELEVKPLLTTTNGKKLKVSVMVDSGCTHTCIDEGLVKKKKIPMKKLEQPITCRNSDGTIA
GKKDITKFAKIDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGMIKFNRCPSSCSFPHTDISFEP
RIRRLQSNEDTEEKELDPTNPEDLPAYMKPFAHLFNRKNFDKLPERTEWDHEINFTENAPTEISSKVYSMTPLER
EELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNEITIKDKTPLPLISEVLDQLKDAKVFNK
LDVIWGYNNVRIREGDE*
Coding >AgabiH97|044810
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGTCATGGTCGACTCGGGATGCACACACACATGTATTGACGAAGGATTA
GTAAAGAAGAAGAAGATCCCGATGAAGAAATTGGAACAGCCGATCACATGCAGGAACTCAGACGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAATCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCTCATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGCCGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACTGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTTAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTAGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAAAAAGACGGATCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACA
ATCAAGGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAGCTCAAAGACGCCAAGGTTTTCAACAAA
TTGGACGTTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATGAATAG
Transcript >AgabiH97|044810
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGTCATGGTCGACTCGGGATGCACACACACATGTATTGACGAAGGATTA
GTAAAGAAGAAGAAGATCCCGATGAAGAAATTGGAACAGCCGATCACATGCAGGAACTCAGACGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAATCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCTCATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGCCGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACTGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTTAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTAGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAAAAAGACGGATCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACA
ATCAAGGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAGCTCAAAGACGCCAAGGTTTTCAACAAA
TTGGACGTTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATGAATAG
Gene >AgabiH97|044810
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGTCATGGTCGACTCGGGATGCACACACACATGTATTGACGAAGGATTA
GTAAAGAAGAAGAAGATCCCGATGAAGAAATTGGAACAGCCGATCACATGCAGGAACTCAGACGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAGTCATCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAATCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCTCATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGCCGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACTGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTTGCCCATCTTTTTAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTAGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAAAAAGACGGATCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACA
ATCAAGGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAGCTCAAAGACGCCAAGGTTTTCAACAAA
TTGGACGTTATCTGGGGATATAACAACGTTCGGATACGAGAAGGAGATGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail